RetrogeneDB ID:
retro_mputfur_1532
Organism:
Location:
GL897216.1:1112301-1112737 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.34 %
Coverage:
94.12 %
Frameshifts:
1
Stop codons:
6


Parental gene:
Parental gene symbol:
ARPC5L
Parental gene aliases:
No gene alias available
Parental gene description:
actin related protein 2/3 complex, subunit 5-like [Source:HGNC Symbol;Acc:23366]

Genomic region (view in browser)





>retro_mputfur_1532
GTGGCCCAGAACACACTGTCCTAGCACTTCCACTAGGTGGACATCAATGAGTTTGATGAG
AACAAATTCGTGGACAAGCAGGAAGAGGCGGCGGCAGCAGCAGACACTGAGCCAGGCCTG
GACCTTAGCGAGGTGGATGGCATTCTGTAGTAAGGGGACATGCTTCCGGCATTTCATGCA
GCCTTACATAACTCTCCCGTTAGCACAAAGAATCAAGCCGTGAAGGAATGAGCCTAGTTT
GTGGTACTGAAAGTGCTTACAAACTTTAAGAGCAGTGCAGTTGTGCAGGCTGTGCACTCA
CGGGACAGAAATGACATTGACTTGCTAATGAGGTACAATTTATAAAGGGTTTGAGAAGCC
TACAGAAAACAGCAGCATGGTGTTACTCCAGTTGCATAAAAAGGCATTAGCAGTAGGAGC
ACTAGGCTTCATTATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAG-EPGPDPSEVDGLLRQWDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQS
.A.NTLS..F..VDI.EFDENKFVD.QEEAAAAA..EPG.D.SEVDG.L...DML.AFHAAL.NSPV.TKNQAVKE.A..VVLKVLTNFKSS...QAV.S
Retrocopy
VAQNTLS*HFH*VDINEFDENKFVDKQEEAAAAADTEPGLDLSEVDGIL**GDMLPAFHAALHNSPVSTKNQAVKE*A*FVVLKVLTNFKSSAVVQAVHS


Parental protein
LDRNGIDLLMKY-IYKGFEKPTENSSAVLLQWHEKALAVGGLGSII
.DRN.IDLLM.Y.IYKGFEKPTENSS.VLLQ.H.KALAVG.LG.I.
Retrocopy
RDRNDIDLLMRY\IYKGFEKPTENSSMVLLQLHKKALAVGALGFIM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide