RetrogeneDB ID:
retro_mputfur_1534
Organism:
Location:
GL897219.1:837624-837982 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
88.52 %
Coverage:
52.84 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
OIP5
Parental gene aliases:
No gene alias available
Parental gene description:
Opa interacting protein 5 [Source:HGNC Symbol;Acc:20300]

Genomic region (view in browser)





>retro_mputfur_1534
GTCACAAATAACATGGTTTTGGAAGCTCCCTTCCTAGTTGGAATTGATGGTTCGCTCAAA
GGCAGCACTTAAAACCTTTTATTCTGCACTTCCTGTGGGATTCCCATTGGTTTCCATTTG
TATTCTACCCATGCTGCTCTGGCTGCCTTGAGAGGTCATTTTTGCCTTTCCAGTGACAAA
ATGCTATCAGTTAAAAACAAAAGCCATAGTAAATGCATCTGAGATGGACATTCACAACTT
GTCTCTACCAGAAAAAGTTGCAGAGCTGAAAGAGAAGATAATGTTAGCATATACTCACTT
ATATTCACTGATGAAGATTCTGAAGGAAGTAACTCCGGACCAGACCAAGTCAGAAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VTNNVVLEAPFLVGIDGSLKGSTYNLLFCTSCGIPIGFHLYSTHAALAALRGHFCLSSNKMVCYQLKTKA-IVNASEMDIHNLSLPEKVAELKEKIMLAH
VTNN.VLEAPFLVGIDGSLKGST.NLLFCTSCGIPIGFHLYSTHAALAALRGHFCLSS.KM.....K.K..IVNASEMDIHNLSLPEKVAELKEKIMLA.
Retrocopy
VTNNMVLEAPFLVGIDGSLKGST*NLLFCTSCGIPIGFHLYSTHAALAALRGHFCLSSDKML--SVKNKS\IVNASEMDIHNLSLPEKVAELKEKIMLAY


Parental protein
TQLYSLMKILKEVTPDQPKSEN
T.LYSLMKILKEVTPDQ.KSEN
Retrocopy
THLYSLMKILKEVTPDQTKSEN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide