RetrogeneDB ID:
retro_mputfur_1539
Organism:
Location:
GL897224.1:564847-565554 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
94.96 %
Coverage:
60.46 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
RBMX
Parental gene aliases:
No gene alias available
Parental gene description:
RNA binding motif protein, X-linked [Source:HGNC Symbol;Acc:9910]

Genomic region (view in browser)





>retro_mputfur_1539
CCACGAAGTGGTGGTCCTCCTCCTAAAAGATCTCCCCCTTCAGGACCAGTTCGCAGCAGC
AGTGGAATGGGAGGAAGAGCTCCTGCGTCACGTGGAAGAGATAGTTATGGAGGCCCACCT
CGAAGGGAACCCCTGCCCTCTCGTAGAGGTGTTTATTTGTCCCCGAGAGATGATGGATAC
TCCACTAAAGACAGCTATTCAAGCAGAGATTACCCAAATTCTCGTGATACAAGAGATTAT
GCACCACCGCCGAGAGATTATACTTACGGTGTTATGGTCATTCCAGTTCACGTGATGACT
ACTCGTCAAGAGGCTATAGTGATAGAGATGGCTATGGTTGTGATCGTGACTATTCAGATC
ATCCAAGTGGAGGCTCCTACAGAGATTCATATGAGAGTTATGGTAACTCACGTAGTGCTC
CACCTACACGAGGGCCCCCGCCATCTTATGGTGGAAGCAGTCGCTATGATGGTTACAGCA
GCTCACGTGACGGATATGGTGGAAGTCGAGACAGTTACTCAAGCAGCCGAAGTGATCTCT
ACTCAAGTGGTCGTGATCGGTTTGGCAGACAAGAAAGAGGGCTTCCCCCTTCTATGGAAA
GGGGGTACCCTCCTCCACGTGATTCCTACAGCAGTTCAAGCCGCGGAGCACCAAGAGGTG
GTGGCCGAGGAAGCCGATCTGATAGAGGGGGATGCAGAAGCAGATAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTY-RDYGHSSSRD
PRSGGPPPKRS.PSGPVRSSSGMGGRAP.SRGRDSYGGPPRREPLPSRR.VYLSPRDDGYSTKDSYSSRDYP.SRDTRDYAPPPRDYTY.R.YGHSSSRD
Retrocopy
PRSGGPPPKRSPPSGPVRSSSGMGGRAPASRGRDSYGGPPRREPLPSRRGVYLSPRDDGYSTKDSYSSRDYPNSRDTRDYAPPPRDYTY/RCYGHSSSRD


Parental protein
DYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSM
DY.SRGYSDRDGYG.DRDYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPSYGGSSRYD.YSSSRDGYGGSRDSYSSSRSDLYSSGRDR.GRQERGLPPSM
Retrocopy
DYSSRGYSDRDGYGCDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPSYGGSSRYDGYSSSRDGYGGSRDSYSSSRSDLYSSGRDRFGRQERGLPPSM


Parental protein
ERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
ERGYPPPRDSYSSSSRGAPRGGGR.GSRSDRGG.RSRY
Retrocopy
ERGYPPPRDSYSSSSRGAPRGGGR-GSRSDRGGCRSRY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide