RetrogeneDB ID:
retro_mputfur_1540
Organism:
Location:
GL897224.1:369957-370293 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
93.75 %
Coverage:
62.92 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
ARPC3
Parental gene aliases:
No gene alias available
Parental gene description:
actin related protein 2/3 complex, subunit 3, 21kDa [Source:HGNC Symbol;Acc:706]

Genomic region (view in browser)





>retro_mputfur_1540
ATGCCGGCTTACCACTCATCTCTTATGGATCTGGACACCAAACTCATTGGAAATGTGGCA
CTGTTGCCTATCAGAAGTCAGTTCAAAGGACCTGCCTCGAGAGAGACAAAAGATACAGAT
ATTGTGGGTGAAGCCATCTATTACTTCAAGGCCAATGTCTTCTTCAAAAACGATGAGATT
AAGAATGAAGCTGATAGAACCTTGATATATATAATTCTCTACATTTCTGAGTGCCTAAAG
AAACTCCAAAAGTGCAGTTCCAAAAGCCAAGGTGAAAAAGAAATGTATACGCTGGGCATC
ACTAATTTTCCCATTCCTGGAGAGCCTGGTTTTCCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGI
MPAYHSSLMD.DTKLIGN.ALLPIRSQFKGPA.RETKDTDIV.EAIYYFKANVFFKN.EIKNEADRTLIYI.LYISECLKKLQKC.SKSQGEKEMYTLGI
Retrocopy
MPAYHSSLMDLDTKLIGNVALLPIRSQFKGPASRETKDTDIVGEAIYYFKANVFFKNDEIKNEADRTLIYIILYISECLKKLQKCSSKSQGEKEMYTLGI


Parental protein
TNFPIPGEPGFP
TNFPIPGEPGFP
Retrocopy
TNFPIPGEPGFP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide