RetrogeneDB ID:
retro_mputfur_1542
Organism:
Location:
GL897225.1:493143-493942 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.09 %
Coverage:
74.45 %
Frameshifts:
4
Stop codons:
4


Parental gene:
Parental gene symbol:
VPS72
Parental gene aliases:
No gene alias available
Parental gene description:
vacuolar protein sorting 72 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:11644]

Genomic region (view in browser)





>retro_mputfur_1542
ATGAGTTTGGCTGGCAACCAGGTCCCCAGAAGACCATGAGGAACCAGGTTTCTGGGTTCC
TGGAGGCACAGGAGGAAGATGAGTTCTATCAGATGATTTATGGGGGTTTCACAGAGGGAT
TGGGAAATAATGAGTATCAAGGGCACCAGTCAGACACAGAGGATTAGGTGGATTCTGACT
TTGACATCCATGAAGGGGATGAACCATCCAGTGACAGAGAAGCAGAAAAACCAAGACGTA
AGTGCTGAGTAGTCATCAAAGCATTAAGGAGCCTCTCAAGATCTTGAGACCTCAAAAAGT
CAGCATTCCAGGTAGTAGCTCTCAGAAGGCCTGATAAGAGAAAGCACTGCTGCCACTAGG
AATTACAGGAAAATGGCTCTGGCAGAATTCCATGTGTTGAGCTGAGCATACATGACAGAC
ATTCCTTTGGGTACAGGAGAGGCAGGGCCAGTCATAGCAGTGAAAGCAGTCCCCACTGCG
AGTGGCTACTGATCCAGGAGGCACTGCTCAGAAAGGCCAAGATCACAGAGCTCAACTTTC
ATTTACTAGAAACATATGAGTGGATCAAGGCTGACAAAAAGAAGCAAGTGCAGAAGAAGC
AGAAGTGCCCTGGGCCCATAATCACCTACCATTCAGTAGCAGTGCTGCCTGTAGGGGAGC
CACACCCTAAAGAAGAGACTGTGGATGTGCAAGGACTTGATCCTGCTCCCACAGATTCTG
CACTGACTCCCTATGCCAGCATTGGACCCATCAACCCTCCTTCTCACTGTCCTGTGCATT
CATAATTTTCAGTGATAAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSLAGGRAPR-KTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEEPRRKRRVVTKA-YKEPLKSLRP
MSLAG...PR.KT..N..SG.LEA.EEDEFYQ..YGGFTE..G..EYQG.QSDTED.VDSDFDI.EGDEPSSD.EAE.PRRK..VV.KA..KEPLK.LRP
Retrocopy
MSLAGNQVPR/KTMRNQVSGFLEAQEEDEFYQMIYGGFTEGLGNNEYQGHQSDTED*VDSDFDIHEGDEPSSDREAEKPRRKC*VVIKA/IKEPLKILRP


Parental protein
RKVSTPAGSSQKAREEKALLPL-ELQDDGSDSRKSMRQSTAEHTRQTFLRVQERQGQSRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADK
.KVS.P..SSQKA..EKALLPL.ELQ..GS........S...H.R..F.....R...S.....PHCE..L.QE.LLR.AKIT.ELN...LETYE...ADK
Retrocopy
QKVSIPGSSSQKA**EKALLPL\ELQENGSGRIPCVELSI--HDRHSFGYRRGRASHS-SESSPHCEWLLIQEALLRKAKIT-ELNFHLLETYEWIKADK


Parental protein
KKQVHKKRKCPGPIITYHSVTVPLVGEPGPKEENVDVEGLDPTPTASALTPRAGTGPIVPPARC-SRTFITFSDD
KKQV.KK.KCPGPIITYHSV.V..VGEP.PKEE.VDV.GLDP.PT.SALTP.A..GPI.PP..C.S..FI.FSD.
Retrocopy
KKQVQKKQKCPGPIITYHSVAVLPVGEPHPKEETVDVQGLDPAPTDSALTPYASIGPINPPSHC/SCAFIIFSDN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide