RetrogeneDB ID:
retro_mputfur_1546
Organism:
Location:
GL897227.1:592957-594295 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.33 %
Coverage:
96.75 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
INTS12
Parental gene aliases:
No gene alias available
Parental gene description:
integrator complex subunit 12 [Source:HGNC Symbol;Acc:25067]

Genomic region (view in browser)





>retro_mputfur_1546
GCACTAGGCTTCCTACATTCAAAGAGTAAGGATTCTGCAGAAAAGCTAAAGGCACTACTT
GATGAATCTTTGGCTCGGGGCATTGATGCAAGTTACCGTCCATCTCAGAAGGATGTAGAG
CCACCCAAAATTTCAAGCGCAAAACCTGTTTCTGTTAAACAAGAGCCCCAAACATCATGC
AGTCTTCTTTCTGGCAATAGCAATGGCGAGGCCCTCACAACTGAAAAAGTACAGACAGAA
GCGGAAAAGAGACCAGCGGATAAAATGGAACCAGACCTCACAGAAGGAGGTGATGCTCCA
AAGAAACCTAGATTGGAGAAACCAGAGACACGGTCCTCTCCCGTTACCGTCCAAACTAGC
AAGGATTTAGCCATGACTGACCTTTCCAGTTTTGAGGAGACTAGTGCCGACGGTTATACC
ATGGAGATGGGATTGGCCTGTGTTGTTTGTAGGCTAATGACACTGGCGTCCTGTGATCAG
TTAGAAGAACGTCAGGAGTGCCCTGATCTCCAGTACCAAGATGGCCGCGAGCCCCAGGCG
ACAGACAAGGAAGTGAATGACCCTCGTCCTGTGTGGAACTGTGCTCCATGAACCGGACAG
ATGAAAAGAATGGATCAAAAAACTCAGAAACCACCACAGAAACCAGCCCCCACAGTCGCT
CCTGTCGCTCCGGCTGTCAAAGAGCCATTGGTTAAGAAACTAGAAACTAAACTCAGAGAC
AACTTTTCTAGCATTTAAGAGAACAGAGGTCAAGACATCCACGGCTATGTCAGGAAATTC
TTCTAGTCCCAGTGTTTCCTCTTCAGGACCTAGTGGCCTAACTGGATGGGCAGCTTTTGC
AGCTAAAACTTCCTTCTCTGCTCCATCCACAGCGAAACTGAATTCAACAACCCAAAATAA
TAGTGGGAAGCCTGCGACCTCATCAGTTAACCAGAAGCCTGTGGGTTTAACTGGTCTGGC
GACATCATCTAAATGTGGAATAGGTTCCAAAACAGGTTCCACCTTCTGTTCCACTGCACC
TTCCATTCCACTGAAACCACCTCCACCTCTAACTTTGGGCAAAACTGCCCTTAGCCGCTC
CATTAGCTGTGACAATGTTAGCAAAGTGGATCTTCTAGTCCAAGTAGTTTAGTTCCAGGA
AGCACCAGCCAGCTCAGTGGGAACGGAAATAGTGGGACATCAGGGCCCAGGGGAAGTACC
ACTAGCAAAACCACTTCAGAATCAAGCAGCTCTCCCTCAGCATCCCTTAACGGTCTGACT
TCACAAGAATCACAGCTCAATGCCATGAAGAGATTACAGATGGTCAAGAAGAAAGCTGTG
CAGAAGAAACTCAAGAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ALGFLHSKSKDSAEKLKALLDESLARGIDSSYRPSQKDVEPPKISSTKTISVKQEPKTSSSLPSANSNGKALTTEKVKKEAEKRPADKMKSDITEGVDIP
ALGFLHSKSKDSAEKLKALLDESLARGID.SYRPSQKDVEPPKISS.K..SVKQEP.TS.SL.S.NSNG.ALTTEKV..EAEKRPADKM..D.TEG.D.P
Retrocopy
ALGFLHSKSKDSAEKLKALLDESLARGIDASYRPSQKDVEPPKISSAKPVSVKQEPQTSCSLLSGNSNGEALTTEKVQTEAEKRPADKMEPDLTEGGDAP


Parental protein
KKPRLEKPETRSSPITVQTSKDLAMTDLSSFEETSADDFAMEMGLACVVCRQMTVASGNQLVECQECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTRQ
KKPRLEKPETRSSP.TVQTSKDLAMTDLSSFEETSAD...MEMGLACVVCR.MT.AS..QL.E.QEC..L..QD...PQ.TDKEVNDPR.VW.CA..T.Q
Retrocopy
KKPRLEKPETRSSPVTVQTSKDLAMTDLSSFEETSADGYTMEMGLACVVCRLMTLASCDQLEERQECPDLQYQDGREPQATDKEVNDPRPVWNCAP*TGQ


Parental protein
MKRMAQKTQKPPQKPAPTVVSVAPAVKDALVKKPETKLKQETTFLAFKR-TEVKTSTAISGNSSSTSVSSSVTSGLTGWAAFAAKTSSAGPSTAKLNSTT
MKRM.QKTQKPPQKPAPTV..VAPAVK..LVKK.ETKL..........R.....T.......S.S.S..SS..SGLTGWAAFAAKTS...PSTAKLNSTT
Retrocopy
MKRMDQKTQKPPQKPAPTVAPVAPAVKEPLVKKLETKLRDNFSSI*ENR\VKTSTAMSGNSSSPSVS--SSGPSGLTGWAAFAAKTSFSAPSTAKLNSTT


Parental protein
QNNSGKPATSSTNQKPVGLTGLATSSKGGIGSKIGSSNSTAPTVPLKPP-PPLTLGKTGLSRSISCDNVSKV-GLPSPSSLVPGSTSQLIGNGNSGTSGP
QNNSGKPATSS.NQKPVGLTGLATSSK.GIGSK.G.............P.PPLTLGKT.LSRSISCDNVSKV.G..SPSSLVPGSTSQL.GNGNSGTSGP
Retrocopy
QNNSGKPATSSVNQKPVGLTGLATSSKCGIGSKTGXXXXXXXXXXXXKPPPPLTLGKTALSRSISCDNVSKV/GSSSPSSLVPGSTSQLSGNGNSGTSGP


Parental protein
SGSTTSKTTSESSSSPSASLKGPTSQESQLNAMKRLQMVKKKAAQKKLKK
.GSTTSKTTSESSSSPSASL.G.TSQESQLNAMKRLQMVKKKA.QKKLKK
Retrocopy
RGSTTSKTTSESSSSPSASLNGLTSQESQLNAMKRLQMVKKKAVQKKLKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide