RetrogeneDB ID:
retro_mputfur_1547
Organism:
Location:
GL897228.1:253816-254161 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.04 %
Coverage:
68.86 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
FAM96B
Parental gene aliases:
No gene alias available
Parental gene description:
family with sequence similarity 96, member B [Source:HGNC Symbol;Acc:24261]

Genomic region (view in browser)





>retro_mputfur_1547
CTGATTCGCTCCATCAATGATCTGGAGCATCCACTGACACTGGAAGAATTGAACGTAGTG
GAGCAAGTCCGGGTTCAGGTGAGCAACCCTGAGAGTACGGTGGCTGTGGCCTTCACACCC
ACCATTCCACACTGCAGCATGGCCACTCTTATCGGCCTGTCCATCAAAGTCAAGCTTCTT
TGATCCCTTCCCCAGCGTTTCAAGATGGATGCGCACACTACACCAGGAACTCATGCCTTG
GAGCATGCAGTGAACAAGCAGCTTGCAGATAAGGAATGGGTAGCAGCTGCTCTAGCGAAT
ACCCACCTGCTGGAGGTTGTGAACCAGTGCCTGTCAGCCCGCTCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LIRSINDPEHPLTLEELNVVEQVRVQVSDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVAAALEN
LIRSIND.EHPLTLEELNVVEQVRVQVS.PESTVAVAFTPTIPHCSMATLIGLSIKVKLL.SLPQRFKMD.H.TPGTHA.EHAVNKQLADKE.VAAAL.N
Retrocopy
LIRSINDLEHPLTLEELNVVEQVRVQVSNPESTVAVAFTPTIPHCSMATLIGLSIKVKLL*SLPQRFKMDAHTTPGTHALEHAVNKQLADKEWVAAALAN


Parental protein
THLLEVVNQCLSARS
THLLEVVNQCLSARS
Retrocopy
THLLEVVNQCLSARS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide