RetrogeneDB ID:
retro_mputfur_1549
Organism:
Location:
GL897235.1:407111-407560 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
76.32 %
Coverage:
59.22 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
PSMA3
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) subunit, alpha type, 3 [Source:HGNC Symbol;Acc:9532]

Genomic region (view in browser)





>retro_mputfur_1549
GTGAGCTCAGTTGGGGCAGGGTATAAATTGTAAGCCTCTACATTCTGTCCTGATGGAAGA
GTTTTTCAAGTTGTATATGCTATTAAGGCTGTGAATAGTAGTATAGCTATTGGAATCAGA
TGTAAAGATGGTGTCATCTTTGGGGTAGAAAAGCTAGTTCTTTCTCAGCTATACAAAAAG
GGTTCCAATGAATGACTTTTTAATGTTGGTCGGCTTTTGGAATGACACTGGCAGATTTGT
TGGCAGATGCTTATTCCTTAGCAGACATTGCAAGAGAAGCAGCTTCCAACTTTAGATCTA
ATTTTGGCCATAACTTTCCATTACAATGTCTTGCAGATAGAGTGGCTATGTATATACATA
CATATACACTGTACAGTGCTGTTAGACCTTTTGGTTCTGTCTACATATTAGGGTCTTATA
GTGTGAATGATGGTGCACAGCTCTACATC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHV-GMAVAGLLADARSLADIAREEASNF
.SS.G.GY.L.ASTF.PDGRVFQV.YA.KAV.NSS.AIGIRCKDGV.FGVEKLVLS.LY..GSN..LFNV.R...GM..A.LLADA.SLADIARE.ASNF
Retrocopy
VSSVGAGYKL*ASTFCPDGRVFQVVYAIKAV-NSSIAIGIRCKDGVIFGVEKLVLSQLYKKGSNE*LFNVGRLL/GMTLADLLADAYSLADIAREAASNF


Parental protein
RSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYM
RSNFG.N.PL..LADRVAMY.H.YTLYSAVRPFG....LGSYSVNDGAQLY.
Retrocopy
RSNFGHNFPLQCLADRVAMYIHTYTLYSAVRPFGSVYILGSYSVNDGAQLYI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide