RetrogeneDB ID:
retro_mputfur_1550
Organism:
Location:
GL897237.1:743818-744193 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.4 %
Coverage:
62.19 %
Frameshifts:
0
Stop codons:
5


Parental gene:
Parental gene symbol:
PSMB2
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) subunit, beta type, 2 [Source:HGNC Symbol;Acc:9539]

Genomic region (view in browser)





>retro_mputfur_1550
ATCCAGGACCCTGACTAAGGCCTTCTCACCTCCAACTAAGTGGCCACTAGCAGTGTTGTC
CAGATGAAGAACGATCAAGACAAGATGCTTAAGAGGAGTGATGAAATCTTATTCCCATGT
GTTAGAGAGGCTGGGGACACAGTACAGTTTGCAGAATATATTCAGCAAAATGACCCACTT
TATAAGATGCAAAATCATTAAGAATGGTCTCCCATAGCAGCACTTAATTTCACATGCTGA
AACGTGACTGGCTATCTTCAGAGTCGGACACCATATCATGGAAATCTCCTGCTGGCTGGC
TATGATGAGCATGAGGGCCCAGCACTCTCTTACAGGGACTACCTGGCAGTATAGGTCAAG
ACTCCTTTTACAGCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IQGPDYVLVASDQVAASSIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAG
IQ.PD..L..S..VA.SS.VQMK.D.DKM.K.S..IL..CV.EAGDTVQFAEYIQ.N..LYKM.N..E.SP.AA.NFT..N....L.SRTPYH.NLLLAG
Retrocopy
IQDPD*GLLTSN*VATSSVVQMKNDQDKMLKRSDEILFPCVREAGDTVQFAEYIQQNDPLYKMQNH*EWSPIAALNFTC*NVTGYLQSRTPYHGNLLLAG


Parental protein
YDEHEGPALYYMDYLAALAKAPFAA
YDEHEGPAL.Y.DYLA...K.PF.A
Retrocopy
YDEHEGPALSYRDYLAV*VKTPFTA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide