RetrogeneDB ID:
retro_mputfur_1553
Organism:
Location:
GL897239.1:786222-786699 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.25 %
Coverage:
51.61 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
NANOG
Parental gene aliases:
No gene alias available
Parental gene description:
Nanog homeobox [Source:HGNC Symbol;Acc:20857]

Genomic region (view in browser)





>retro_mputfur_1553
GAGAGCACAGTGAAGAAGGAAGATACAGTCCAGAGCAAGAAACAGAAGACCAGAACCATA
TTCTCTCGGTCCAGCTATATGTACTTAGTGACAGATCTCAGAGACAGAAATACCTGTTTC
CAGCAGATGCAAGAACTTTCTAACTTTCTTAACTTTTGCTATAAGCAGGTGAAGACCTGG
TTCCAGAACCAGAGAATGAAATGTAAGAGGCAGCAGGAAAACAACTGGCCAATGAATAGC
AAAAGTGTGACTCAGAATAGCTCAGCAACTATAGAATACCTAGGCTTATATGCCTACTCC
CAGGGATTCCTGATGAATGCTTTTGGGAACCTTCCAACATGGAGCAGCCAGACCTGGTAT
AACCCACATTGGAGCAATTAGACCTGGAAAAGCCAGTCTTGGAGCAACTGTTCCTGGAAT
AGTCAGACCCGGTGGCCCCAAGCCTGGAACAACCAGGCATGGAACAATCAGCTGTGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ERTGRREDTAQGKKQKIRTVFSQTQ-LYVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKCKRWQKNHWPKESKSVTQNSTAATEYPAFYS
E.T...EDT.Q.KKQK.RT.FS.....Y...D...R......QQMQELSN.LN..YKQVKTWFQNQRMKCKR.Q.N.WP..SKSVTQNS.A..EY...Y.
Retrocopy
ESTVKKEDTVQSKKQKTRTIFSRSSYMYLVTDL--RDRNTCFQQMQELSNFLNFCYKQVKTWFQNQRMKCKRQQENNWPMNSKSVTQNSSATIEYLGLYA


Parental protein
YHQGHLMNTSANLPIWSSQTWNNPNWSNQTWNSQSWSNHSWNGQSWSNHSWTSQTWCPQAW
Y.QG.LMN...NLP.WSSQTW.NP.WSN.TW.SQSWSN.SWN.Q......W..Q.W..Q.W
Retrocopy
YSQGFLMNAFGNLPTWSSQTWYNPHWSN*TWKSQSWSNCSWNSQTRWPQAWNNQAWNNQLW


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide