RetrogeneDB ID:
retro_mputfur_1554
Organism:
Location:
GL897241.1:303910-304633 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.68 %
Coverage:
98.78 %
Frameshifts:
4
Stop codons:
3


Parental gene:
Parental gene symbol:
EIF4E2
Parental gene aliases:
No gene alias available
Parental gene description:
eukaryotic translation initiation factor 4E family member 2 [Source:HGNC Symbol;Acc:3293]

Genomic region (view in browser)





>retro_mputfur_1554
AAGTTCAGTGCACTGAAATATGATGACAGTGGGGACCATGATCTGAATGAAGTAAACAGC
ACAGAGAAGGAAAAAACATAAAGAGACAGGAGTCAGGGCACCAGTAAGACGAAGGCTGTT
GCCCCTGGACCAGCAGAGCATCTCCTCCTGCAGTACAGCAATACTTTCTGATATGCCAGA
AGAACCCAGGATGTCTCACCAGCTTACAGAGTTGTGAATAAAATATCAAACAGATTGGCA
CCCTTTGCCTTTGCAGAGCAGTTCTGGAGGTTTTACAGTCATATGGTAGGTCCTGGGGAC
CTGACAGGCCACAAGGACTTTCATTTCTTCAAAGAAGGAAATAAATCCATTTGGGAAGAT
GATGCAAAAAAAAAAAAAAATGGTGGCAAGTGGATTATTTGGTTCCAGAAAGGCTTGGCA
TCTCATTGCTGTAAGAATCTTATCCTGGACATGCTGGAGAACAGTTCGTGGCTGGGGAGG
AGATCTGTGGGGCTGTGGTCTCTGTCCAGTTTCAGAAGGACATTATTTCAATATGGAGTA
AGACTGCCAGTGACCAAGCAACCCACAGTCCAAATCCAGGAAATGATTTGGCGAGTGCTT
AACCTACCTCTCAACACCATTATGGAGTACAAAACCCACACTGGCAGCATCGAAATGTCA
GGCAGGCTGGGCCCCCAAAGGGTCCTTTTTCAAAACCTCTGTAAGCTACAGTTGAATGTG
CCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KKDRLKDDDSGDHDQNEENSTQKDGEKEKMERDKNQGSSKRKAVVPGPAEHPL-QYNYTFWYSRRT-PGRPTSSQSYEQNIKQIGT-FASVEQFWRFYSH
K...LK.DDSGDHD.NE.NST....EKEK..RD..QG.SK.KAV.PGPAEH.L.QY..TF.Y.RRT.PG..TS.QS.E.NIKQIGT.FA..EQFWRFYSH
Retrocopy
KFSALKYDDSGDHDLNEVNST----EKEKT*RDRSQGTSKTKAVAPGPAEHLLLQYSNTF*YARRT/PGCLTSLQSCE*NIKQIGT\FAFAEQFWRFYSH


Parental protein
MVRPGDLTGHSDFHLFKEGIKPMWEDDANKN--GGKWIIRLRKGLASRCWENLILAML-GEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQAT-TARI
MV.PGDLTGH.DFH.FKEG.K..WEDD......GGKWII...KGLAS.C..NLIL.ML.GEQF..GEEICGAVVSV.FQ.DIISIW.KTASDQAT.T..I
Retrocopy
MVGPGDLTGHKDFHFFKEGNKSIWEDDXXXXXXGGKWIIWFQKGLASHCCKNLILDML/GEQFVAGEEICGAVVSVQFQKDIISIWSKTASDQAT\TVQI


Parental protein
RDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
.....RVLNLP.NTIMEYKTHT.SI.M.GRLGPQR.LFQNL.K..LNVP
Retrocopy
QEMIWRVLNLPLNTIMEYKTHTGSIEMSGRLGPQRVLFQNLCKLQLNVP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide