RetrogeneDB ID:
retro_mputfur_1555
Organism:
Location:
GL897241.1:388579-389054 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.21 %
Coverage:
89.27 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
CNBP
Parental gene aliases:
No gene alias available
Parental gene description:
CCHC-type zinc finger, nucleic acid binding protein [Source:HGNC Symbol;Acc:13164]

Genomic region (view in browser)





>retro_mputfur_1555
CCACTGGGCCCGGGGATGTCCTAGGGCAGGAGGGAGTCGAGGGCGCGGAGCCAGAGGCCG
TGGTAGAGGTTCTCCGTGCAGTTCCACCAACCTGTCTGACATCTGCTACCGCTGTGGTGA
GTCTGGCCATCATGCTAAGAACTGTGACCTTCTCGAGGACATTTGCTACAACTGTGGGAG
AAGTGGCCACATCGCTAAAGACTGTATGGAGCCGAAGAGAGAGAGAGAGCAGTGCTGTTA
CACTTGTGGCCGACCAGGCCATCTGGCTCGTGACTGTGACCGTCAGGAAGAACCGAAGTG
CTACTCTTGCGGTGAATATGGCCATATTCAGAAAGACTGTACCCAAGTCAAGTGCTACCG
GTGTGGTGAGATCGGCCACGTGGCCATCAACTGCAGCAAAGCAAGCGAAGTCAACTGCTA
CCGCTGTGGCGAGTCCGGGCATTTGGCCCGGGAATGCCCCATTGAGGCTACTGCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PTGGGRGRGMR-SRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQK
P.G.G...G.R.SRGRG.....RG....S..L.DICYRCGESGH.AK.CDL.ED.CYNCGR.GHIAKDC.EP.....QCCY.CG.PGHLARDCD...E.K
Retrocopy
PLGPGMS*GRR\SRGRGARGRGRGSPCSSTNLSDICYRCGESGHHAKNCDLLEDICYNCGRSGHIAKDCMEPXXXXXQCCYTCGRPGHLARDCDRQEEPK


Parental protein
CYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA
CYSCGE.GHIQKDCT.VKCYRCGE.GHVAINCSK.SEVNCYRCGESGHLAREC.IEATA
Retrocopy
CYSCGEYGHIQKDCTQVKCYRCGEIGHVAINCSKASEVNCYRCGESGHLARECPIEATA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide