RetrogeneDB ID:
retro_mputfur_1557
Organism:
Location:
GL897247.1:476531-477521 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.9 %
Coverage:
66.47 %
Frameshifts:
2
Stop codons:
6


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1557
AACATCCAAGCTGTGCACACCCAGGAGATCAAGACCATCAACATCAAATTTGCCTCCTTC
ATCAACAAAATGAGGCACCTGGAGTAGCAGAATAAAATTCTGGAGACCAAGTGGAGCCTT
CTACAGCATCAGAAAACTACTCAGAGCAACAACGACATGTTCAAGAGCTACATCAACAAC
CTCTGGTGGCAACTGGACACCCTGGGCCCAGAGAAGCTGGAGGTAGAGCTTGGCAACATG
CAGGGGCTGGTGGAGGACTTCAAGAATAAATAGGAGGAGATCAAAGAGCCTGCAGACACT
GAGAATGATTTTGTCCTCATAAAGAAGGGTGTGGATGAAGCTTACATGAACAAGGTAGAA
CTAGTCTCCCACCTGGATGGGCTGACTGACGAGATCAGCTTCTTAAGGCAGCTGTATGAA
GAGGAGATCGTGAGCTACAGTCCTAGATCTCCAACACATCAGTGGTGCTATCCATGGACA
AGACCTGCTCCCTGGACATAGATGGTATGATCGCTGAAGCCAATGCCCAATATGAAGACA
TTGCCAACCATACCCGGGGTGCAGCCAAGACCATGTACCAGATCAAGTAGGAGGAGCTGC
AGACACTGGCTGGGAAACACAGGGATGACCTCAGTAGAGATGAAGATTTCCAAGATGAAC
CAGAGAAGCAGCTGACACCAGGCTGAGATTGAGGCCCTCAGAAACCAGAGGGCCAGCCTA
GAGGCTGCCATTGCTGATGCCAAGCACCATGAGGAGTTGGCCATTAAGGATGCCAGTGCT
AAGGTGGCTGAGCTGGAGGCTGCCCTGCAGTGAGCCAAGCAGGACATGGCCCAGCACCTG
TGTGAATACCAGGAACTCGTGAACGTCAAGCTGGTTCTGGAAATTGTGATTGCCACCTAC
CACAAGCTGCTGGGAGGTGAGGAGAGCTGGCTGGAGTCTGGGATGCAGAACATGAGTATC
CATACTAAGACCATCAGCGTCTTCCCAGGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NIQAVRTQEKEQIKTLNNKFASFIDKVRHLEQQNKVLETKWSLLQQQKTARSNIDNMFESYISNLRRQLDTLGQEKLKLEVELGNMQGLVEDFKNKYEEE
NIQAV.TQE...IKT.N.KFASFI.K.RHLE.QNK.LETKWSLLQ.QKT..SN.D.MF.SYI.NL..QLDTLG.EKL..EVELGNMQGLVEDFKNK.EE.
Retrocopy
NIQAVHTQE---IKTINIKFASFINKMRHLE*QNKILETKWSLLQHQKTTQSNND-MFKSYINNLWWQLDTLGPEKL--EVELGNMQGLVEDFKNK*EE-


Parental protein
IKERADMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEI-RELQSQISDTSVVLSMDNSRSLDLDGIISEVKAQYEDIANRSRAEAETM
IKE.AD.EN.FVLIKK.VDEAYMNKVEL.S.L.GLTDEI.FLRQLYEEEI.RELQS.IS.TSVVLSMD...SLD.DG.I.E..AQYEDIAN..R..A.TM
Retrocopy
IKEPADTENDFVLIKKGVDEAYMNKVELVSHLDGLTDEISFLRQLYEEEI/RELQS*ISNTSVVLSMDKTCSLDIDGMIAEANAQYEDIANHTRGAAKTM


Parental protein
YQIKYEELQTLA-GKHGDDLRRTKTEISEMNRSISRLQAEIEALKNQRAALEAAIADAEQRGELAIKDANGKVAELEAALQRAKQDMARQLREYQELMNV
YQIK.EELQTLA.G..G.........IS.MN...S..QAEIEAL.NQRA.LEAAIADA....ELAIKDA..KVAELEAALQ.AKQDMA..L.EYQEL.NV
Retrocopy
YQIK*EELQTLA\GNTG--MTSVEMKISKMNQRSS*HQAEIEALRNQRASLEAAIADAKHHEELAIKDASAKVAELEAALQ*AKQDMAQHLCEYQELVNV


Parental protein
KLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGFSG
KL.L.I.IATY.KLL.GEES.LESGMQNMSIHTKT.S.F.G
Retrocopy
KLVLEIVIATYHKLLGGEESWLESGMQNMSIHTKTISVFPG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide