RetrogeneDB ID:
retro_mputfur_1559
Organism:
Location:
GL897250.1:263069-263380 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
79.25 %
Coverage:
81.4 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
COX5B
Parental gene aliases:
No gene alias available
Parental gene description:
cytochrome c oxidase subunit Vb [Source:HGNC Symbol;Acc:2269]

Genomic region (view in browser)





>retro_mputfur_1559
ATTGAAAGGGTGCGCACCATGGCATCTGGAGGTGGTATTCCTACTGATGATGACCAGGCG
ACTGGGCTGGAGAGGGAGGTCATGATGGCTGCATGGAAAAGACTGGACCCATACAATATG
CTAGCCCCAAAGGCAGCTGCAGGCACCAAGGAAGACCCTAATTTATTCCCATCTATCACC
AACAAGCTAATAGTGGGCTGCATCTGTGAAGAGGACAATAGTACCGTCATCTGGTTCTCC
ACAAAGGCGAGGCCCAGTGGTGCCTTAGCTGTGGAACCCATTACAAGCTGGTGCCCCACC
AGCTGGCCCAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VAAVRTMASRGGIPTDDDQATGLEREVMMAARKGLDPYNLLAPKAAAGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFW-LHKGEAQRCPSCGTHYKLV
...VRTMAS.GGIPTDDDQATGLEREVMMAA.K.LDPYN.LAPKAAAGTKEDPNL.PSITNK.IVGCIC.E..........LHKGEAQ.C.SCGTHYKLV
Retrocopy
IERVRTMASGGGIPTDDDQATGLEREVMMAAWKRLDPYNMLAPKAAAGTKEDPNLFPSITNKLIVGCIC-EEDNSTVIWF/LHKGEAQWCLSCGTHYKLV


Parental protein
PHQLAH
PHQLAH
Retrocopy
PHQLAH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide