RetrogeneDB ID:
retro_mputfur_1560
Organism:
Location:
GL897253.1:58435-58721 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
56.12 %
Coverage:
62.18 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
SFT2D2
Parental gene aliases:
No gene alias available
Parental gene description:
SFT2 domain containing 2 [Source:HGNC Symbol;Acc:25140]

Genomic region (view in browser)





>retro_mputfur_1560
ACTGGATTGCTGTGGCTTCCTGGTGTTATAAAGCTCTTTGTAGCATTTTATACCCTTGGA
AATACTGCTGCATTAGCCAGGATGTGCTTTTCAGTGGTATCCATGAAGCAACTGAAGAAA
ACGTCTGAAACAAGACTGCTTGCAACAATTATTATGCTCCTGTGTTTCATATTTACGCTG
TGTGCTGCTCTTTGGTGGCACAAGAGGGGACAGGCCTTATTATTCTGTATACTGCAGTTT
CTTGTCAATGACCTGGTGTAGTCTGTCATATAACCCACATGCAAGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TFLLWVPRKGLYLFAVFYTFGNIASIGSTVFLMGPMKQLKRMFEPTRLIATIMVLLCFALTLCSAFWWHNKGLALIFCILQ-SLALTWYSLSYIPYAR
T.LLW.P.....LF..FYT.GN.A......F....MKQLK...E.TRL.ATI..LLCF..TLC.A.WWH..G.AL.FCILQ..L..TW.SLSY.P.AR
Retrocopy
TGLLWLPGV-IKLFVAFYTLGNTAALARMCFSVVSMKQLKKTSE-TRLLATIIMLLCFIFTLCAALWWHKRGQALLFCILQ\FLSMTWCSLSYNPHAR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide