RetrogeneDB ID:
retro_mputfur_1561
Organism:
Location:
GL897254.1:794734-795317 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.79 %
Coverage:
57.49 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
Ldhb
Parental gene aliases:
No gene alias available
Parental gene description:
lactate dehydrogenase B [Source:MGI Symbol;Acc:MGI:96763]

Genomic region (view in browser)





>retro_mputfur_1561
ATATTCTCATGTGTTACCTGGAAACTAAGTGGACTTAGTGACTGGAAGCCCTGTGTGACT
GGAAGTGAGTATAGCCTGGGTTCTGCTAGATTTCACTATTTTATGGCTGAAAAAAATTGG
CTTTCTTCCTCGCAGTTGCCATGGTTGGATTTGGGGAGAATATGGCAACTCAAGGGTGGC
TGTGTCGAGTGGAATGAATGTGGCAGGTGTTTCTCTCCAGGAATTGAACCTAGAAATGGG
AACAGATAATGACAGTGAAAACTGGAAGTAAATGCATAAAATGATGGTTAAAAGTGCATA
CAATATCATCAAGCTAAAAGGATATGCCACCTGGGCTACTGGATTAAGTGTGGCTGATCT
CATTAAAGCCATGCTAAAATATCTACCCAGGATTCATCCAGTGTCAACGATGGTAAAGGG
AATCCATGGCATAGAGAAAGAAGCCTTCCTGAGCCTTCCATGAATCCTGGATGCTCAAGG
ATTAACCAGTGCTCTCAGCCAGAAGCTAAAGGATGCTGAGTTTCCTCAGCTCAAGAAAAG
TGCAGATACCTTATGGAACATACAGAAAGACCTAAAAGACCTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ILTYVTWKLSGLP--KHRVIGSGCNLDSARFRYLMAEK-LGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPDMGTDNDSENWKEVHKMVVESA
I...VTWKLSGL...K..V.GS...L.SARF.Y.MAEK..G..P.SCHGWI.GE.G.S.VAV.SG.NVAGVSLQELN..MGTDNDSENWK..HKM.V.SA
Retrocopy
IFSCVTWKLSGLSDWKPCVTGSEYSLGSARFHYFMAEK\IGFLPRSCHGWIWGEYGNSRVAVSSGMNVAGVSLQELNLEMGTDNDSENWK*MHKMMVKSA


Parental protein
YEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Y..IKLKGY..WA.GLSVADLI..MLK.L.RIHPVSTMVKG..GIE.E.FLSLP.IL.A.GLTS...QKLKD.E..QLKKSADTLW.IQKDLKDL
Retrocopy
YNIIKLKGYATWATGLSVADLIKAMLKYLPRIHPVSTMVKGIHGIEKEAFLSLP*ILDAQGLTSALSQKLKDAEFPQLKKSADTLWNIQKDLKDL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide