RetrogeneDB ID:
retro_mputfur_1562
Organism:
Location:
GL897254.1:630581-630898 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
74.77 %
Coverage:
90.6 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
RPL36
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L36 [Source:HGNC Symbol;Acc:13631]

Genomic region (view in browser)





>retro_mputfur_1562
GCCACGGCTCTGCGCTACCCCATGGCCGTGGGTCTCAACAAGAGACACAAGGTGACTAAG
AAGGTGAGCAAGCTGGGGCACTGCCACCGCCATGGGTGCCTCACCAAGCACACCAAGTTC
ATGCGGACATGATCTGAGAGGTGGGAGGCTTCGCTCCCTGTGAATGGTGAGCCATGGAGC
TGCTCAAGTTCTCCAAGGACAAGCACGCCCTCAAGTTCATCAAGAAAAGAGTGGAGGCAC
ACATCCATGCCAAGAGCAAGAGAGAGGAGCTGAGTAATGTCCTCACCGCCATGAAGAAAG
TGACAGATAAGAAGGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AMALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVR-DMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMR
A.ALRYPMAVGLNK.HKVTK.VSK..H..R.G.LTKHTKF.R.DMI.EV.GFAP.E..AMELLK.SKDK.ALKFIKKRV..HI.AK.KREELSNVL.AM.
Retrocopy
ATALRYPMAVGLNKRHKVTKKVSKLGHCHRHGCLTKHTKFMR/DMI*EVGGFAPCEW*AMELLKFSKDKHALKFIKKRVEAHIHAKSKREELSNVLTAMK


Parental protein
KAAAKKD
K...KKD
Retrocopy
KVTDKKD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide