RetrogeneDB ID:
retro_mputfur_1563
Organism:
Location:
GL897258.1:234115-234614 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.78 %
Coverage:
80.68 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
NFYB
Parental gene aliases:
No gene alias available
Parental gene description:
nuclear transcription factor Y, beta [Source:HGNC Symbol;Acc:7805]

Genomic region (view in browser)





>retro_mputfur_1563
ATGACAACCAGTGGCGATAGCGCTACGACAGATGCTTCTCTACTAGGCATGGCTGCACAC
TACATGGGAAGAAGCCACTATGTGATTCAGTCTCATGATGACACTGAGCACAGCGTGAAT
GATCATGAAGACACAAATAGTTCAAAACACAGTTTCAGAGAACGCGATATCTATCTTCCA
ACTGCAAATGTAGCAAGGATAATGAAAAATGTCATACCTCAAATGGGAAAGGTTGTAAAA
TGCCAAGGACTGTTTTCAAGAATGAGTAAGTGAGCTCATCAGCTTTGTAACATCTGAAGC
AAAGGAAAGATGCCATCAAGAGAAACGGAGGACAATCAAGCGAGAAGAAATTCTCTTTGC
CATGCTGACCTCAGGTTGTGGTGGTTCTGTTGAACTTCTAAAATTATCCTTTCAGAAATT
CAGAGAGGCTATGAAAGGAGAGAAAGGAGTTGGTGGAAGACTCAGAGCTACAGATGGACG
AAGTGAAGAACTTACAGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MTMDGDSATTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLPIANVARIMKNAIPQ-TGKIAK-DAKECVQECVSEFISFIT
MT..GDSATTDAS.LG..A.Y.G.SHYVIQ.HDDTE.S.NDHEDTN.SK.SFRE.DIYLP.ANVARIMKN.IPQ..GK..K..AK.C.QE.VSE.ISF.T
Retrocopy
MTTSGDSATTDASLLGMAAHYMGRSHYVIQSHDDTEHSVNDHEDTNSSKHSFRERDIYLPTANVARIMKNVIPQ/NGKGCK/NAKDCFQE*VSELISFVT


Parental protein
SEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGTVTATDGLSEELTE
SEA.ERCHQEKR.TI..E.ILFAM.T.G....VE.LKL..QKFREAMKGEKG.GG...ATDG.SEELTE
Retrocopy
SEAKERCHQEKRRTIKREEILFAMLTSGCGGSVELLKLSFQKFREAMKGEKGVGGRLRATDGRSEELTE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide