RetrogeneDB ID:
retro_mputfur_1568
Organism:
Location:
GL897260.1:55041-55847 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.29 %
Coverage:
53.31 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
ZCCHC4
Parental gene aliases:
No gene alias available
Parental gene description:
zinc finger, CCHC domain containing 4 [Source:HGNC Symbol;Acc:22917]

Genomic region (view in browser)





>retro_mputfur_1568
CATTATAGCATGTTTAACAATCATGTCTTTGATAGAAAGACTGCGTTTGAAGTATGAAGA
ACATTTTCATGGGAAGATAAAGGTGAGGGAGTCATTATGGTGACAGATCCTCCTTTTGGT
GGTTTTGCTGAACCTCTGGTTATTACATTCAAGAAATAAATTGCTCTGTGGAAAGAAGAT
CAAAACCAAGAAAACCAACCACCCATATTCTGGATTTTTCCCCTAATTTTTTCAATCCCA
AAGTTGTCTGTTTTTTCCAAGCTCCTGCATGCTGAATTACCAGATAGATTATGATAATCG
TATACCTTATACACATGGAAAGACAGGTTGAAAACAGTCTCCTGTGCATATTTTCACCAA
TATTCCAACCAGCAAAATAATCCTTCCTATTGAAGAAGGGTACAGATTTTGCCTCTGTGT
TAATGATGTTTCCTAGAAAATCAACACTGTGAGCACTGTAATCCTTATACATCCAAGGAT
GACAAGAATGGAACCATTGCTTTTCCTGCATAAAGTGTCTAAAACCTTACTGGATCCACT
GTAGCATTTGCAGTCATTGTGCTCTTCCAGATCATTCTCACATGGGCCCCAAAGATGGCT
GCTTTATTTGTGGTGAATTAGGTAATAAAAGTAGTACTTGTCCTAACATCTCTATATCTA
AGAAAGTGAACAAAGCTATCAACATGCAGAAGCAAAGAAAAAGTAATAAGATGAAAATGG
AGACCACTAAAGGACAATCCATGAATCATACATCTGTTACAAGGAAGAAAAAAAGGAGAG
AAAGAGCCCATCTTTATCTTTGCTCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
HYNMFNHHFFDGKAALEVCRTFLQEDKGEGVIMVTDPPFGGLVEPLAVTFKKLIAMWKEGQSQDSSQKELPIFWIFPY-FFEFRIRQFFPSFCMLDYQVV
HY.MFN.H.FD.K.A.EV.RTF..EDKGEGVIMVTDPPFGG..EPL..TFKK.IA.WKE.Q.Q.......PIFWIFP..FF......FFPS.CML.YQ..
Retrocopy
HYSMFNNHVFDRKTAFEV*RTFSWEDKGEGVIMVTDPPFGGFAEPLVITFKK*IALWKEDQNQENQP---PIFWIFPL\FFQSQSCLFFPSSCMLNYQI-


Parental protein
DYDNHALYKHGKTGRKQSPVRIFTNIPPNKIILPSEEGYRFCPLCQRYVS-LENQHCEHCNSCTSKDGR-KWNHCFLCKKCVKPSWIHCSICSHCALPDH
DYDN...Y.HGKTG.KQSPV.IFTNIP..KIILP.EEGYRFC.LC...VS.LENQHCEHCN..TSKD....WNHCF.C.KC.KP.WIHCSICSHCALPDH
Retrocopy
DYDNRIPYTHGKTG*KQSPVHIFTNIPTSKIILPIEEGYRFC-LCVNDVS/LENQHCEHCNPYTSKDDK/EWNHCFSCIKCLKPYWIHCSICSHCALPDH


Parental protein
SCGGPKDGCFICGELDHKRSTCPKITTSKKVNKAVRKQKQRKSNKMKMGTTKGQSMNHTSVTRKKRRRERAHQYLCS
S..GPKDGCFICGEL..K.STCP.I..SKKVNKA...QKQRKSNKMKM.TTKGQSMNHTSVTRKK.RRERAH.YLCS
Retrocopy
SHMGPKDGCFICGELGNKSSTCPNISISKKVNKAINMQKQRKSNKMKMETTKGQSMNHTSVTRKKKRRERAHLYLCS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide