RetrogeneDB ID:
retro_mputfur_1571
Organism:
Location:
GL897263.1:506219-507328 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
93.01 %
Coverage:
53.08 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
PRKRIR
Parental gene aliases:
No gene alias available
Parental gene description:
protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor) [Source:HGNC Symbol;Acc:9440]

Genomic region (view in browser)





>retro_mputfur_1571
AGTCCTTATAGGACAGTTCTTCGAGATAATGCAATACCAACAATATTTGATCTTACCAGT
CATTTGAACTATCCACATAGTAGACACAGAAAACGAATAAAAGAATTGAGTGAAGATGAA
ACCAGGACACTGAAACAGAAAAAAAATTGATGAAACTTCTTAACAGGAACCAAAACATAA
AGAGATAAACAGCAACGCTCAGAATCCTAGTGCAGAAGAAGGGGGTGAGGAACAGGATGA
AGATATTTTACCTTTAACCCTTGAAGAGAAAGAAAACAAAGAATACTTAAAATCTCTATT
TGAAATTTTGATTCTTATGGGAAAACAAAACATACCTCTGGATGGGCATGAAACTGATGA
AATCCCAGAGGGTCTCTTTACTCCTGATAACTTTGAAGCGCTGCTGAAGTGCCGGATAAA
TTCTGGTGAAGAGGTTCTGACAAAGCGCTTTGAGACAACAGCAGTTAACACATTGTTCTG
CTGGAAAACACAGCAGAAACAGATGATAGAGATCTGTGAGAGCTGCATTTGGGAAGAAAC
TCTCAGGGAAGTGAGAGACGCGCACTTCTTTTCCATCATCACTGATGACGTAGTGGACAT
AGCAGGAGAAGAACACTTGCCTGTGTTGGTGAGGTTTGTTGATGAATCTCATAACCTGAG
AGAGGAATTTGTGGGCTTCTTGCCTTGTGAAGCTGATGCAGAAATTTTGGCTGTGAAATT
TCACACTACCATAACTGAGAAGTGGGGGGTTAAACATGGAGTATTGTCGTGGCCAGGCTT
ACATTGTGTCCAGTGGATTTTCTTCCAAAATGAAAGTTGTTGCTTCTAGACTTTCAGAGA
AATATCCCCAAGCTGTCTACACACTTTGCTCATCTTGTGCCTTAAATATGTGGCTGGCAA
AATCAGTGCCTGTTGTGGGAGTGTCTGTTGCGTTAGGAACAATTGAGGAAGTTTGTTCTT
TGTTCCATCGATCCTCACAACTGCTTTTGGAGCTTGACAATGTAATTTCTGTCCTCTTTC
AGAACAATGAGGAAAAGGGTAAAGAACTGAAGGAGATCTGCCATTCTCAGTGGACAGGTA
GGCATGATGCACTTGTTTTATGTTTAGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SPYRTVLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKKI-DETSEQVPKHKEINNSNAQNPSAEEGGEEQDEDILPLTLEEKENKEYLKS
SPYRTVLRDNAIPTIFDLTSHLN.PHSRHRKRIKELSEDE.RTLKQ....DETS.Q.PKHKEI.NSNAQNPSAEEGGEEQDEDILPLTLEEKENKEYLKS
Retrocopy
SPYRTVLRDNAIPTIFDLTSHLNYPHSRHRKRIKELSEDETRTLKQXXX\DETS*QEPKHKEI-NSNAQNPSAEEGGEEQDEDILPLTLEEKENKEYLKS


Parental protein
LFEILILMGKQNIPLDGHETDEIPEGLFTPDNFQALLECRINSGEEVLRKRFETTAVNTLFCSKTQQKQMLEICESCIREETLREVRDSHFFSIITDDVV
LFEILILMGKQNIPLDGHETDEIPEGLFTPDNF.ALL.CRINSGEEVL.KRFETTAVNTLFC.KTQQKQM.EICESCI.EETLREVRD.HFFSIITDDVV
Retrocopy
LFEILILMGKQNIPLDGHETDEIPEGLFTPDNFEALLKCRINSGEEVLTKRFETTAVNTLFCWKTQQKQMIEICESCIWEETLREVRDAHFFSIITDDVV


Parental protein
DIAGEEHLPVLVRFVDESHNLREEFVGFLPYEADAEILAVKFHTTITEKW-GLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAVYTLCSSCALNMW
DIAGEEHLPVLVRFVDESHNLREEFVGFLP.EADAEILAVKFHTTITEKW.GLNMEYCRGQAYIVSSGFSSKMKVVASRL.EKYPQAVYTLCSSCALNMW
Retrocopy
DIAGEEHLPVLVRFVDESHNLREEFVGFLPCEADAEILAVKFHTTITEKW\GLNMEYCRGQAYIVSSGFSSKMKVVASRLSEKYPQAVYTLCSSCALNMW


Parental protein
LAKSVPVVGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNNEEKGKELKEICHSQWTGRHDAFEILVD
LAKSVPVVGVSVALGTIEEVCS.FHRS.QLLLELDNVISVLFQNNEEKGKELKEICHSQWTGRHDA.....D
Retrocopy
LAKSVPVVGVSVALGTIEEVCSLFHRSSQLLLELDNVISVLFQNNEEKGKELKEICHSQWTGRHDALVLCLD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide