RetrogeneDB ID:
retro_mputfur_1572
Organism:
Location:
GL897264.1:485498-485900 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.7 %
Coverage:
93.24 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
COA1
Parental gene aliases:
No gene alias available
Parental gene description:
cytochrome c oxidase assembly factor 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:21868]

Genomic region (view in browser)





>retro_mputfur_1572
TCTCTAGGAAGCAGCATGCCATTGCCTCTGGGGAAACTGGTTCTTTTTTCCAGTGTGGTG
GCCAGTGGGAGCTGTGCCCTTATACAGAAAGCTTTTTCTAGGGCTTCCTTTTACCAGCTG
GCACTGGAACAGCTACACAACCACCCTGAGGTGCTGGTGGCTTTGTATACTTCTCTCAAC
GTCTACTATCTCCACTTCATCAACAAGTACAACTTTGTGGACATTGCCAATGCCTAGTTG
AAGATTCCTGTCTCTGGATACAAGTCAGAGGGCCATCTCTATGTCAGCTCAGCCAGGGGT
GCCCCTTTCAGAGGGTGGCACCTTCAGGAGGTCTTCTTTAGTGTCGAGGATGGTCAACAG
TAAAGTGTGTTCAAATTCAGTGGGGACACTGATGACAAAGTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SPGSSMPWALGRMVLSSGALAAGSCALIYYLTQKAFSKASYYQLALEQLHSRPEALEALGAPLSVHHLHLTDRDNFVDITSARLKIPVSGSKSQGLLHVH
S.GSSMP..LG..VL.S...A.GSCALI....QKAFS.AS.YQLALEQLH..PE.L.AL...L.V..LH.....NFVDI..A.LKIPVSG.KS.G.L.V.
Retrocopy
SLGSSMPLPLGKLVLFSSVVASGSCALI----QKAFSRASFYQLALEQLHNHPEVLVALYTSLNVYYLHFINKYNFVDIANA*LKIPVSGYKSEGHLYVS


Parental protein
SSRDGPFQRWRLQEVFLKLQDGQQIPVFKLSENTGHEV
S.R..PF..W.LQEVF....DGQQ..VFK.S..T...V
Retrocopy
SARGAPFRGWHLQEVFFSVEDGQQ*SVFKFSGDTDDKV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide