RetrogeneDB ID:
retro_mputfur_1573
Organism:
Location:
GL897266.1:717045-717367 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.45 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
ATP5J
Parental gene aliases:
No gene alias available
Parental gene description:
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6 [Source:HGNC Symbol;Acc:847]

Genomic region (view in browser)





>retro_mputfur_1573
ATGACTCTTCCCACACTTTTCAGTTTCTCTGCTCTCATTCAGTCTGAAGTCTCAGTTTAT
TGAAGAGGCACATTGGTATTACAGCAGTGGCATTTAATGAGGACCTTGATCTTGTACAAA
AACTCTTCATGGACAAGATTACAGAATACAGAATGAAGCTATGGGCATCTGGAGGACATG
CCAACAGTGGCCCAGAGACCCAGCTAGACCTAGAGAGGGAGCTTTTGAAGCTTAAGCAAA
TGTATGGTCAAGCGGATATAAATATGTCCCATACTTTACATGTGAAGATCCTAAATTTGC
AGTAATAGAAAAGCCCCAGACC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MILQRLFGLSSLIRSAVSVH-LRRNIGVTAVAFNKELDPVQKLFVDKIREYRTKRQASGGPVDTGPEYQQDLERELFKLKQMYGKADMNT-FPDFKFEDP
M.L..LF..S.LI.S.VSV..L.R.IG.TAVAFN..LD.VQKLF.DKI.EYR.K..ASGG....GPE.Q.DLEREL.KLKQMYG.AD.N...P.F..EDP
Retrocopy
MTLPTLFSFSALIQSEVSVY/LKRHIGITAVAFNEDLDLVQKLFMDKITEYRMKLWASGGHANSGPETQLDLERELLKLKQMYGQADINM/VPYFTCEDP


Parental protein
KFEVIEKPQS
KF.VIEKPQ.
Retrocopy
KFAVIEKPQT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide