RetrogeneDB ID:
retro_mputfur_1576
Organism:
Location:
GL897271.1:642108-642637 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
78.69 %
Coverage:
85.92 %
Frameshifts:
6
Stop codons:
1


Parental gene:
Parental gene symbol:
BTF3
Parental gene aliases:
No gene alias available
Parental gene description:
basic transcription factor 3 [Source:HGNC Symbol;Acc:1125]

Genomic region (view in browser)





>retro_mputfur_1576
TCTCTTCCTCCACCTCATGGCAGAACCCCAGGACAGAACCTCAGATGAAAGAAACTATCA
TGAACCAGGAGAAACTCACCAAACTGCAAGCACAAGAGCGCATTGGTGGGAAAGGAATTA
CTTCCCAAAACAAGAAAGTGTTTATAGAACAGCTACAGCAGATGGTAAAAAAACTTCAGT
TCGCCTTAAAGAAGTTAGCGGTAAACAATATCTCTGATATTGAAGAAGTAAATATGTCCA
CAAACCAAGGAACAGTGATCACTTTAACAACTCCAAAGTTCAGGCATTGCTGGTGCTGAA
AACTTTCACCATTTTAGGGCATGCTGACACAAAGCAGCTGATGAAGTGCTACCCAATATC
TTAAATCAACTTGATGTGGACAATCTGACTAGTTTAAGAAGACTGGCTGAAGCTCTGCCC
AAACAATTCTGTGGATGGAAAAATACCACTTGCTACCTGAGAGGATGATGATAATGAAGT
TCCAGATCTTGTAGAGAATTTTAATGAAGCTTCCAAGAATGAAGCAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SLPPPRGGTRGQ-EPQMKETIMNQEKLAKLQAQVRIGGKGTARRKKKV-VHRTATADD-KKLQFSLKKLGVNNISGIEEVNMFTNQGTVI-HFNNPKVQA
SLPPP.G.T.GQ.EPQMKETIMNQEKL.KLQAQ.RIGGKG.....KKV.V.RTATAD..KKLQF.LKKL.VNNIS.IEEVNM.TNQGTVI.HFNN.KVQA
Retrocopy
SLPPPHGRTPGQ/EPQMKETIMNQEKLTKLQAQERIGGKGITSQNKKV/VYRTATADG\KKLQFALKKLAVNNISDIEEVNMSTNQGTVI/HFNNSKVQA


Parental protein
SLAANTFTITGHAETKQL-TEMLPSILNQLGADSLTSLRRLAEALPKQ-SVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN
.L...TFTI.GHA.TKQL..E.LP.ILNQL..D.LTSLRRLAEALPKQ.SVDGK.PLAT.EDDD.EVPDLVENF.EASKNEAN
Retrocopy
LLVLKTFTILGHADTKQL/DEVLPNILNQLDVDNLTSLRRLAEALPKQ\SVDGKIPLAT*EDDDNEVPDLVENFNEASKNEAN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide