RetrogeneDB ID:
retro_mputfur_1577
Organism:
Location:
GL897271.1:265562-266282 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.87 %
Coverage:
99.19 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
RPL7L1
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L7-like 1 [Source:HGNC Symbol;Acc:21370]

Genomic region (view in browser)





>retro_mputfur_1577
CAGCAAGAGCAAAGATAGAAGATCCCTCTGGTTCCAGAAAATCTGAAAAAGATGATGGCT
TATCAGGCCCTTGAAGCCTCTCAAGCAAAGCAGGCACTTTTGGACAAGGAGCAGAAGAAA
GGAAAAGAGCTCAGTTTTAAGGGACCGAAATGGTTCTTATATTATTCCCGGTGGCAGCAA
CATGACAGGTTGCGCCTCAGACGACTAGAAGGGAAACCTTGTGGCTTGGAAGTGCCAGAT
AAATATTCCTTGGGCTCTGCTGTATGCATCCAAAGGATGAATGGGGTGAGTTCACTGGTG
CAGAGGACTACTGCCAGGCTTCGCCCGAAGATTTTCAGTGATGTCTTTTTCAGAGTAACC
CCCCAGACCATAAAAACACTACATACAGTGGAAACTTACATGACCCGAGGACTTCCAAAT
CTGAAGTCTGCCCAGAAACTCATCTTGAAACATGGACAAGACAAGGTGAAGAATAAAACC
ATCCCTTTGACAGACAACACAGTGATTGACGAGCACCTGGGGAAGTAGGGTGTTACTTGC
TTGGAAGATCTCATTTATGAAATTGTCTTTCCAGGGAAGAACTTCCAGATCTCTGCATTC
TTACATCCTTTCCATCTCTCAGTGGCCTATCCTGCTACCAAGAATAGTGGGCTTCCTCAA
GGAGGTGGGCTTACCTGGCTCTCGAGGGGACACATCAATCAGCTCATTTGTCAGCTGAAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EQEQRKKIPLVPENLLKKRKAYQALKATQAKQALLDKKEQKKGKQLKFKRLEWFLHDSWRQQRDRVRLRRLEVKPRGLEVPDKHSLAFVVRIQRINGVSS
.QEQR.KIPLVPENL.KK..AYQAL.A.QAKQALLDK.EQKKGK.L.FK...WFL..S..QQ.DR.RLRRLE.KP.GLEVPDK.SL...V.IQR.NGVSS
Retrocopy
QQEQR*KIPLVPENL-KKMMAYQALEASQAKQALLDK-EQKKGKELSFKGPKWFLYYSRWQQHDRLRLRRLEGKPCGLEVPDKYSLGSAVCIQRMNGVSS


Parental protein
LVQRTIARLRLKKIFSGVFFRVTPQTIKMLRIVEPYVAWGFPNLKSVRELILKRGQAKVKNKTIPLTDNTVIEEHLGKYGVICLEDLIHEIAFPGKNFQE
LVQRT.ARLR..KIFS.VFFRVTPQTIK.L..VE.Y...G.PNLKS...LILK.GQ.KVKNKTIPLTDNTVI.EHLGK.GV.CLEDLI.EI.FPGKNFQ.
Retrocopy
LVQRTTARLR-PKIFSDVFFRVTPQTIKTLHTVETYMTRGLPNLKSAQKLILKHGQDKVKNKTIPLTDNTVIDEHLGK*GVTCLEDLIYEIVFPGKNFQ-


Parental protein
ISAFLRPFHLSVARHTTKNRVGFLKEVGL-PGYRGE-RINQLIRQLN
ISAFL.PFHLSVA...TKN..G.....GL.PG.RG...INQLI.QLN
Retrocopy
ISAFLHPFHLSVAYPATKNS-GLPQGGGL\PGSRGD/HINQLICQLN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide