RetrogeneDB ID:
retro_mputfur_1578
Organism:
Location:
GL897273.1:314254-315358 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.67 %
Coverage:
99.73 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
ARPC1B
Parental gene aliases:
No gene alias available
Parental gene description:
actin related protein 2/3 complex, subunit 1B, 41kDa [Source:HGNC Symbol;Acc:704]

Genomic region (view in browser)





>retro_mputfur_1578
ATGTCCCTACATCAGTTTTTACTAGAGCCAATCACCTGTCATGCCTGGAACAGGGATCGT
ACCCAGATTGCTCTTAGCCCCAACACTCACGAAGTCCACATCTATAAGAAGAACAGGAGC
CAGTGGGTGAAAGCTCATGAGCTCAAGGAGAATAACGGACACATTACAGGTATCGACTGG
GCTCCCAAGAGTGACCACATCGTCACTTGTGGGGCAGACCGCAATGCCTACGTCTGGAGT
CAGAAAGATGGTGTCTGGAAGCCAACCCTGGTGATCCTGAGAATTAATCGTGCAGCGACT
TTTGTCAAGTGGTCCCTGCTAGAGAACAAATTTGCTGTGGGAAGTGGAGCACGACTCATT
TCTGTTACTTTGAGTCTGAAAATGACTGGTGGGTAAGCAAGCACATTAAGAAGCCGATTC
GCTTCCACGGTCCTCAGCTTGGATTGGCATCCCAACAATGTCTTGCTGGCAGCAGGATCC
TGTGATTTCAAATGCAGAGTGTTTTCTGCCTACATTAAAGAAGTGGATGAAAAGCCAGCC
AGTACACCCTGGGGCAGCAAGATGCCTTTTGGTCAGCTGATGTCAGAGTTCGGGGGCAGT
GGCACCGGCGGCTGGGTGCATGGGGTCAGCTTCTCTGCCAGCGGGAGTCGCCTGGCCTGC
GTCAGCCACGACAGCACCGTATCAGTTGCTGACGCCTCAAAAAGCCTGCAGGTCTCAACT
CTGAAAACAGAGTTCCTGCCCCTCCTGAGTGTGTCATTTGTCTCAGAGAATAGCGTTGTA
GCCGCGGGCCATGACTGCTGCCCAATGCTCTTTAACTACGATGACCGTGGCTGCTTGACC
TTTGTCTCCAAACTAGACATTCCAAAACAGAGCATTCAGCGCAACATGTCTGCTATGGAA
CGCTTCCGCAACATGGACAAGAGGGCCACGACTGAGGACCGCAACACAGCCTTGGAGACG
CGGCACCAGAATAGCATCACTCAAGTGTCTATTTATGAAGTGGACAAGCAAGATTATCGC
AAATTTTACAATACTGGCATCGATGGAGCCATGACAATTTGGGATTTCAAGACCTTAGAG
TCTTCCATCCAGGGCCTCCGGATA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWVKVHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGHTWKPTLVILRINRAAR
M..H.FL.EPI.CHAWN.DRTQIA..PN.HEVHIY.K....WVK.HELKE.NG..TGIDWAP.S..IVTCG.DRNAYVW..K...WKPTLVILRINRAA.
Retrocopy
MSLHQFLLEPITCHAWNRDRTQIALSPNTHEVHIYKKNRSQWVKAHELKENNGHITGIDWAPKSDHIVTCGADRNAYVWSQKDGVWKPTLVILRINRAAT


Parental protein
CVRWAPQENKFAVGSGSRVISIC-YFEQENDWWVCKHIKKPIR-STVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELM--F
.V.W...ENKFAVGSG.R.IS..........W.V.KHIKKPIR.STVLSLDWHPNNVLLAAGSCDFKCR.FSAYIKEV.E.PA.TPWGSKMPFG.LM..F
Retrocopy
FVKWSLLENKFAVGSGARLISVT/FESENDWW-VSKHIKKPIR\STVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEF


Parental protein
ESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDGTTGTLSFGGRLDVPKQSSQRGL
..S...GWVHGV.FSASGSR.A.VSHDSTV..ADA.K...V.TL..E.LPLL...F...NS.VAAGHDC.P.LF.YD...G.L.F...LD.PKQS.QR..
Retrocopy
GGSGTGGWVHGVSFSASGSRLACVSHDSTVSVADASKSLQVSTLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYD-DRGCLTFVSKLDIPKQSIQRNM


Parental protein
TARERFQNLDKKASSDGSVASGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKI
.A.ERF.N.DK.A...........L...H.NS..Q.S.....K.....F..TG.DG.M.IWD.K.LES....L.I
Retrocopy
SAMERFRNMDKRATTED---RNTALETRHQNSITQVSIYEVDKQDYRKFYNTGIDGAMTIWDFKTLESSIQGLRI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide