RetrogeneDB ID:
retro_mputfur_1579
Organism:
Location:
GL897274.1:467356-467860 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
70.29 %
Coverage:
98.29 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
RPS10
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S10 [Source:HGNC Symbol;Acc:10383]

Genomic region (view in browser)





>retro_mputfur_1579
GCAGCTGCTGAGATGTTCATGATCAAGAAGAACCCTCTGTCATTTATGAACTCCTTTTCA
AGGAGGGAGTGATAGTGGCCAAAAAGGATGTCCACATGCCTAACACCCTGAGCTGGCAGA
CAAGAATGTACCCGGTCTTCATGCTGTCAAGGCCATGCTGTCTCTCAGATCATGAGGCTA
CATAAAGGAATACATTGCCTAGAGACATTTCTACTGGAAACTTACCAACAAGGTTATCCA
GTATCTCTGGGATTACCTCCACCTGCCCGCTGAAATTGTGCCTGCCACTCTGCACCACAG
CAGTCTTGAGACTGAAAGGCCACAGTCTAAAGGTCTGAGGGGAGAGCCACCTGCAAGACC
CACACAGGGGAAGCTAACAGAGACACCTACAGACAAAGTGCTGTGTCTCTTGGTGCTGGC
AAGAAAGCTGAGGCTAGGGCAGGGGCAGCAACTGAATTCCAGTTTAGAGGTGAATTTGGT
CCTGGACATGGTCAGCCACCTCAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ASFQMLMPKKNRIA-IYELLFKEGVMVAKKDVHMPK-HPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATL
A...M.M.KKN....IYELLFKEGV.VAKKDVHMP..HPELADKNVP.LH..KAM.SL.S.GY.KE..A.RHFYW.LTN..IQYL.DYLHLP.EIVPATL
Retrocopy
AAAEMFMIKKNPLS/IYELLFKEGVIVAKKDVHMPN/HPELADKNVPGLHAVKAMLSLRS*GYIKEYIA*RHFYWKLTNKVIQYLWDYLHLPAEIVPATL


Parental protein
RRSRPETGRPRPKVCIGLEGERPARLTR-GEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQPPQ
..S..ET.RP..K...GL.GE.PAR.T..GEA.RDTYR.SAV..GA.KKAEA.AG.ATEFQFRG.FG.G.GQPPQ
Retrocopy
HHSSLETERPQSK---GLRGEPPARPTQ/GEANRDTYRQSAVSLGAGKKAEARAGAATEFQFRGEFGPGHGQPPQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide