RetrogeneDB ID:
retro_mputfur_1582
Organism:
Location:
GL897279.1:118395-118712 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.56 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
ATP5J
Parental gene aliases:
No gene alias available
Parental gene description:
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6 [Source:HGNC Symbol;Acc:847]

Genomic region (view in browser)





>retro_mputfur_1582
ATGATTCTTCAGAGGCTCTTCAGGTTCTCCTCTCTTATTCGGTCTGTAGTCTCAGTTTAT
ATTAGGAGGAATGTTAGTGTGACAGCAGTAGCACTTAATAAGGAATTGTTCCTGTAGAGA
AACCCTTCCTGAACAGGATTGGAGAATATAAAAGTAAGCCACAGGCGTCTGGAGAACCCA
TTGATACTGGCCCAGAGTACTAGCAAGACCTAGACAGGGAACTTCTTAAGCAAATGTACA
GTAAAGCAGATATGGGTATGTTCCTGGACTTCAAATTTGAAGATCCTAAATTTGAAGTCA
TCGAAAAATGCCAAACC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MILQRLFGLSSLIRSAVSVHLRRNIGVTAVAFNKELD-PVQKLFVDKIREYRTKRQASGGPVDTGPEYQQDLERELFKLKQMYGKADMNTFPDFKFEDPK
MILQRLF..SSLIRS.VSV..RRN..VTAVA.NKEL..PV.K.F...I.EY..K.QASG.P.DTGPEY.QDL.REL..LKQMY.KADM..F.DFKFEDPK
Retrocopy
MILQRLFRFSSLIRSVVSVYIRRNVSVTAVALNKELF/PVEKPFLNRIGEYKSKPQASGEPIDTGPEY*QDLDREL--LKQMYSKADMGMFLDFKFEDPK


Parental protein
FEVIEKPQS
FEVIEK.Q.
Retrocopy
FEVIEKCQT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide