RetrogeneDB ID:
retro_mputfur_1585
Organism:
Location:
GL897280.1:386903-387305 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
97.76 %
Coverage:
74.86 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
MRPL13
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial ribosomal protein L13 [Source:HGNC Symbol;Acc:14278]

Genomic region (view in browser)





>retro_mputfur_1585
TTGCATAAACCTATATACCATCAACTGAGTGACTGTGGGGATCATGTGGTCATAATGAAC
ACAAGGCACATTGCATTTTCTGGAAATAAATGGGAACAAAAAGTTTACTCCTCACATACT
GGCTATCCAGGGGGATTTAAACAAGTAACAGCTGCTCAGCTACACCAGAAGGATCCAGTA
GCAATCGTGAAACTAGCTATTTATGGCATGCTGCCAAAAAACCTTCACAGAAGAACTCTG
ATGCAGAGATTGCATCTTTTCCCAGATGAGGACATACCAGAAGATATTCGTAAGAATTTA
GTAGAAGAGTTGCCTCAACCACGAAAAGTACCCAAACGTCTAGATGAGTACACACAGGAA
GAAATAGAGGCTTTCCCAAGACTGTGGTCTCCACCTGAAGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LHKPIYHQLSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFKQVTAAQLHQKDPIAIVKLAIYGMLPKNLHRRTLMQRLHLFPDEDIPEDIRKNL
LHKPIYHQLSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFKQVTAAQLHQKDP.AIVKLAIYGMLPKNLHRRTLMQRLHLFPDEDIPEDIRKNL
Retrocopy
LHKPIYHQLSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFKQVTAAQLHQKDPVAIVKLAIYGMLPKNLHRRTLMQRLHLFPDEDIPEDIRKNL


Parental protein
VEELPQPRKVPRRLDEYTQEEIEAFPRLWSPPLD
VEELPQPRKVP.RLDEYTQEEIEAFPRLWSPP.D
Retrocopy
VEELPQPRKVPKRLDEYTQEEIEAFPRLWSPPED


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide