RetrogeneDB ID:
retro_mputfur_1586
Organism:
Location:
GL897281.1:270272-270593 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.0 %
Coverage:
55.67 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
SLMO2
Parental gene aliases:
No gene alias available
Parental gene description:
slowmo homolog 2 (Drosophila) [Source:HGNC Symbol;Acc:15892]

Genomic region (view in browser)





>retro_mputfur_1586
ATGAATATCTGGACTTCAGAGAGCATCTTTGACCACCTATAGGAAACTGTTATAACAGCT
ACAATACAGAAATACCCAAACTCTATGAACCCAAATGTGGTTGGAACTGATTTATTGGAT
AGACTTCTAGATCCCTCTGGAAAGTTACGTAGCCATACACTTTTCAGCACAGAAGGGTTG
CCTTCCATTGTGAAATCTCTTATTGGTGCAGCAAGAACTAAAACACAGGTACAAGAACAT
TCTGTAGTTGATCCTACAGAGAAAACAATGGAATTTCAATCTACTAGTATTTTATTTACA
AATACAATTTCAGTAGTTGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKIWTSEHVFDHPWETVTTAAMQKYPNPMNPSVVGVDVLDRHVDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVVDPVEKTMELKSTNISF
M.IWTSE..FDH..ETV.TA..QKYPN.MNP.VVG.D.LDR..DPSGKL.SH.L.STE.GLPSIVKSLIGAARTKT.VQEHSVVDP.EKTME..ST.I.F
Retrocopy
MNIWTSESIFDHL*ETVITATIQKYPNSMNPNVVGTDLLDRLLDPSGKLRSHTLFSTE-GLPSIVKSLIGAARTKTQVQEHSVVDPTEKTMEFQSTSILF


Parental protein
TNMVSVDE
TN..SV.E
Retrocopy
TNTISVVE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide