RetrogeneDB ID:
retro_mputfur_1588
Organism:
Location:
GL897289.1:177706-178287 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
85.13 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
RHOA
Parental gene aliases:
No gene alias available
Parental gene description:
ras homolog family member A [Source:HGNC Symbol;Acc:667]

Genomic region (view in browser)





>retro_mputfur_1588
ATGGCTGTCATCCAGAAGAAACTGGTGATTATTGGTGATGGAGCCTGTGGCAAGACTTGT
TTGCTCATCGTCTTTAGCAAGGACCAGTTCCCAGAGGTGTATGTACCCACAGTGTTTTAG
AACTATGTGGCAGATATGGAAGTTGATGGAAAGCCGGTAGAGTTGGCTTTGTGGGATACA
GCTGGGCAGGAAGATTATGACTGCTTGAGGCCTCTCTCCTATCCGGACACTGATGTTATA
CTGATGTGTTTCTCCATTGACAGCCCTGATAGTTTAGAAAATATCCCAGAAAAAAATGGA
CCCCGGAAGTCAAGCACTTCTGTCCCAACGTGCCCATCATCCTGGTTGGGAACAAGAAGG
ATCTTTGGAATGATGAGCACACAAAGCGGGAGCTAGCCAAGATGAAGCAGGAGCCGGTGA
AACCTGAAGAAGGCAGAGATATGGCAAACAGGATCGGCGCTTTTGGATACATGAAGTGTT
CAGCAAACACCAAAGATGGAGTGAGGGAGGTTTTTGAAATAGCCACGAGAGCTGCTCTGC
AAGCCAGAAATGGGAAGAAAAAATCTGGGTGCCTTGTCTTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT
MA.I.KKLVI.GDGACGKTCLLIVFSKDQFPEVYVPTVF.NYVAD.EVDGK.VELALWDTAGQEDYD.LRPLSYPDTDVILMCFSIDSPDSLENIPEK..
Retrocopy
MAVIQKKLVIIGDGACGKTCLLIVFSKDQFPEVYVPTVF*NYVADMEVDGKPVELALWDTAGQEDYDCLRPLSYPDTDVILMCFSIDSPDSLENIPEKNG


Parental protein
P-EVKHFCPNVPIILVG-NKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
P.......P..P....G.NKKDL.NDEHT.RELAKMKQEPVKPEEGRDMANRIGAFGYM.CSA.TKDGVREVFE.ATRAALQAR.GKKKSGCLVL
Retrocopy
PRKSSTSVPTCPSSWLG/NKKDLWNDEHTKRELAKMKQEPVKPEEGRDMANRIGAFGYMKCSANTKDGVREVFEIATRAALQARNGKKKSGCLVL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide