RetrogeneDB ID:
retro_mputfur_1592
Organism:
Location:
GL897294.1:433805-434372 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
81.68 %
Coverage:
62.83 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
UNG
Parental gene aliases:
No gene alias available
Parental gene description:
uracil-DNA glycosylase [Source:HGNC Symbol;Acc:12572]

Genomic region (view in browser)





>retro_mputfur_1592
TGCGGCAGTCAGTCCCCCCAAGAAGGCCCGGCCCGGGCTGGGCAGGAGGACCCCGGCATG
CTGCCCTCCTTGCCACTGAGCCCAGAGCAGTTGATCCGTATCCAGAGGAACAAGGCCGCC
GCCCTGCTTGGACTCGCCACGCCCAACGTTCCGTAGGGTTTCGGTGAGAGTTGGAAGAAG
CTGTTCAGTGCGGAGTTGGGGAAACCATATTTAATCAAGCTAATGGGATTTGTCGTGGAA
GAAAGAAAACATTACACTGTTTATTCATCCCTACACCAAGTCTTCATGTGAACCCAGATG
TGTGACATAAGACAGGTGAAGGTTGTTATCCTGGGACAGGATCCGTATCATGGACCCAAC
CAAGCCCATGGGCTCTGCTTTAGTGTTCAAAGACCCATTCCACTGCTACCCAGTTTGGAG
AACACTTATAAAGAGCTGTCTACAGACATAGAGAGTTTCGTTCATCCAGGTCACGGAGAT
TTATCCGGATGGGCCAAGCAAGGTGTTCTCTTACTCAATGCTGTTCTCACAATCCAGGCA
CATCAGGCTAATTCTCATTAGGAGAGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
CGDHLQASPPKKARAGQEDPGTPPSSPLSPEQLIRIQRNKAAALLRLAARNVPVGFGESWKKPLSAEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWT
CG.......P..ARAGQEDPG..PS.PLSPEQLIRIQRNKAAALL.LA..NVP.GFGESWKK..SAE.GKPY.IKLMGFV.EERKHYTVY...HQVF..T
Retrocopy
CGSQSPQEGP--ARAGQEDPGMLPSLPLSPEQLIRIQRNKAAALLGLATPNVP*GFGESWKKLFSAELGKPYLIKLMGFVVEERKHYTVYSSLHQVFM*T


Parental protein
QMCDIRHVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEGFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKER
QMCDIR.VKVVILGQDPYHGPNQAHGLCFSVQRP.P..PSLEN.YKELSTDIE.FVHPGHGDLSGWAKQGVLLLNAVLT..AHQANSH.ER
Retrocopy
QMCDIRQVKVVILGQDPYHGPNQAHGLCFSVQRPIPLLPSLENTYKELSTDIESFVHPGHGDLSGWAKQGVLLLNAVLTIQAHQANSH*ER


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide