RetrogeneDB ID:
retro_mputfur_1593
Organism:
Location:
GL897302.1:384676-385315 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.07 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
Atp5o
Parental gene aliases:
No gene alias available
Parental gene description:
ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit [Source:MGI Symbol;Acc:MGI:106341]

Genomic region (view in browser)





>retro_mputfur_1593
ATGGCTGTCCCAGGTGTGTCTGGCTGGTCCCAGAAAGTGCAATGTTTTAGTACAACTGTA
GTCAGGCCATTTTTTCAAGCTCATGCAGCCACCTGTTCAGGTATATGGCATCTAACATTG
CTATGCCACTGCTCTTTATTCCACTGCATCTAAACAGAATAAACTGGAACAAGTAGAGAA
AGATTGTTGAGAGTAGAACAAATCTTGAAAGAACCCCAAATGGCTGCTGCTTCCATTATG
AATCCCTATAAATAGTGTTCTGTGAAAGTGAAAAGCCTAAATGACATAAGCACAAAAGAG
ACGTTCTCTCCTCTCACATCCAACCCAATCAATGTGTTCATAAAGTATGGTCACTTGGAC
AATACCGCTGGAGTCATTTATGCCTTTTTGACCATGATAAGAATCCACCATGGAGAAGTA
CTGTGCACGGTGACCACTGCATCTCCTTTAGATGAAGACACTCTTAATAAATTAAAAATG
GCCCTGAAAAGCTTCCTAAATAAAGGCTAGGTCTTCAAATTGGAAGTTAAGACTGATCCA
TCAGTCATGCATGAAATGATTGTCTGTATCAGAGAGAAATATGCTAAGTCTGTGAAAACC
AAGATTCAGAAGCTAAGCAGGGCCATGCTGGAGGTTTTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAVPAVSGLSRQVRCFSTTVVRPFS-KLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKE-LLRVAQILKEPKMAA-SIMNPYIKRSVKVKSLNDMSA
MAVP.VSG.S..V.CFSTTVVRPF..KL..PPVQVYGI...YATALYS.ASKQNKLEQVEK..LLRV.QILKEP.MAA.SIMNPY...SVKVKSLND.S.
Retrocopy
MAVPGVSGWSQKVQCFSTTVVRPFF\KLMQPPVQVYGI*HCYATALYSTASKQNKLEQVEKD/LLRVEQILKEPQMAAASIMNPYK*CSVKVKSLNDIST


Parental protein
KERFSPLTSNLINLLAENGRLDNTPGVISAFSTMMSVHRGEVPCTVTTASPLDEATLTELKTVLKSFLSKGQVLKLEVKTDPSIMGGMIVRIGEKYADMS
KE.FSPLTSN.IN.....G.LDNT.GVI.AF.TM...H.GEV.CTVTTASPLDE.TL..LK..LKSFL.KG.V.KLEVKTDPS.M..MIV.I.EKYA..S
Retrocopy
KETFSPLTSNPINVFIKYGHLDNTAGVIYAFLTMIRIHHGEVLCTVTTASPLDEDTLNKLKMALKSFLNKG*VFKLEVKTDPSVMHEMIVCIREKYA-KS


Parental protein
AKTKIQKLSRAMREVF
.KTKIQKLSRAM.EVF
Retrocopy
VKTKIQKLSRAMLEVF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide