RetrogeneDB ID:
retro_mputfur_1594
Organism:
Location:
GL897307.1:1450-2028 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.87 %
Coverage:
56.46 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
NT5C3B
Parental gene aliases:
No gene alias available
Parental gene description:
5'-nucleotidase, cytosolic IIIB [Source:HGNC Symbol;Acc:28300]

Genomic region (view in browser)





>retro_mputfur_1594
CCAGCCTCATAGAGCTGCTGAGCTGCCCTGAGCTCTCCCTGGGCCCAGTGCAGAGCTGGT
ATCAGTGCTTCTCAGGTCTTGGGACAGGTGACATCCTGATGAAGACCAGGGTCCTGATGT
TGGCAGTCTGGACAGGGGTAAGAGATTGTTGGCACCCACTGCAGGGGTGGAGGAGACCAC
TTACAGGTCATTTCTGATTTTGACATGAACTTGAGCAGGTTTGCATGCAGTGAATGGACT
TGTAAGAAGTGATGGACTTCTTACAACATTCTAGAGAGCAGCAAGATCATCAGCGGTGAG
CAATACTGGAATGAGCTTAAGCAGCTCCTTCACCACTATTATCCAGCTGAGATTGACCCA
CACTGCACCATCATAGAGAAGTTACTTCATCTAAGGGACTGGTGGACCAAAGCACATGAT
TGTCCATGCCAGCAGATGATTGAGAAGTTTCAGATAGCCCAAGTGATTAGAGTGTCCAAT
GCAATGCTTAGGGAGGGATTCAAGACAAGACATTCCTCAATAATCTCTAACAACATAACT
TTTTCCTTTTCATCTTTTCCACAGACCTTGGTGATATC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PASQGCGAGAGLPLGPARCRGQRFSRVSGQVST-LMKATVLMR-QPGRVQEIVGALRRGGGDRLQVISDFDMTLSRFAYNGKRCP---SSYNILDNSKII
PAS..C.A....P....R..G...S.V.GQV...LMK..VLM..Q.G...EIVG...RGGGD.LQVISDFDM.LSRFA.....C.....SYNIL..SKII
Retrocopy
PAS*SC*AALSSPWAQCRA-GISASQVLGQVTS/LMKTRVLML\QSGQG*EIVGTHCRGGGDHLQVISDFDMNLSRFACSEWTCKK*WTSYNILESSKII


Parental protein
S-EECQNELKALLHHYYPIEIDPHRTIKEKLPHMVEWWTKAHDLLCQQKIQKAQIAQVVKESNAMLREGYKTFFNTLYQNNIP-LFIF--SAGIGDI
S.E...NELK.LLHHYYP.EIDPH.TI.EKL.H...WWTKAHD..CQQ.I.K.QIAQV...SNAMLREG.KT.......NNI...F.F..S...GDI
Retrocopy
SGEQYWNELKQLLHHYYPAEIDPHCTIIEKLLHLRDWWTKAHDCPCQQMIEKFQIAQVIRVSNAMLREGFKTRHSSIISNNIT/FFLFIFSTDLGDI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide