RetrogeneDB ID:
retro_mputfur_1595
Organism:
Location:
GL897309.1:434877-435313 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
71.23 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
Rpl26
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L26 [Source:MGI Symbol;Acc:MGI:106022]

Genomic region (view in browser)





>retro_mputfur_1595
ATAAAGTTCAATCCCTTTGTGACTCCTGACTGGATCAAGAACAGTACAAGCCATTTCAGT
GCACCTTCTCACACTTACAGGAAGATTATGTCTTCCTTCCTTTCCAAAAAGCTGAGACAG
AAGTACAACGTTCAATCCATGCCCATTCAAAAGGATCATGAAGTACAATTTATGTGAGGA
CATCACAAAGGTCAGCATATTGGCAAAGCAGTCCAAGTTTACAGGATGAAATACATCATC
TACACTGAATGAGTTCTGTGAGAGGAAGTGAATGGTACAACTCTCCATGTGGGCATTCAC
CCTAGCAATGTGGTTAGCACTAGAATAAAACTGGACAGAGATGACAAAAAGATCCTTGAA
TGTAAAGCCAAATCTCACCAAGTAGGTAAGGAAAAAGAGCAAATATAGAGCAGAAACAAC
TGAGAAGATGCAGGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIH
.KFNPFVT.D..KN...HF.APSH..RKIMSS.LSK.LRQKYNV.SMPI.KD.EVQ...GH.KGQ.IGK.VQVYR.KY.IY.E.V..E..NGTT.HVGIH
Retrocopy
IKFNPFVTPDWIKNSTSHFSAPSHTYRKIMSSFLSKKLRQKYNVQSMPIQKDHEVQFM*GHHKGQHIGKAVQVYRMKYIIYTE*VL*EEVNGTTLHVGIH


Parental protein
PSKVVITRLKLDKDRKKILERKAKSRQVGKE-KGKYKEETIEKMQE
PS.VV.TR.KLD.D.KKILE.KAKS.QVGKE.K.KY..ET.EKMQE
Retrocopy
PSNVVSTRIKLDRDDKKILECKAKSHQVGKE\KSKYRAETTEKMQE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide