RetrogeneDB ID:
retro_mputfur_1596
Organism:
Location:
GL897311.1:184914-185639 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
76.33 %
Coverage:
85.61 %
Frameshifts:
1
Stop codons:
9


Parental gene:
Parental gene symbol:
CNOT7
Parental gene aliases:
No gene alias available
Parental gene description:
CCR4-NOT transcription complex, subunit 7 [Source:HGNC Symbol;Acc:14101]

Genomic region (view in browser)





>retro_mputfur_1596
ATACCAGCAGCAACTGTGGATCATAACTAAAGAATTTCTGTAGTTTGAGCTTGCAACCTG
GACAAAGAGATAAAGAAAATTCATTCAGTTATCTGACAATATAATTATGTTCCTATGGGC
ACAGAGTTTCCAGATGTGGTTGCAAGACCTATTGGAGAATTCAGGAACAATGCTGGCTAT
TAATACCAACTATTGTGATGCAGTGTAGACTAACTAAAGATAATTTAGCTAGGACTGACA
TTTATGAATGAGCAAGAAGACTAACCTCCAGGAACTTCAACTTTGCAGTTTAATTTTAAA
TTTAATTTGACAGAGGACATGTATGCCCAGAACTCTATAGAGCTACTAACAACATCTGGA
ATCTGGTTTAAAAAACCTGAGAAGGAAGGAATTGATACCCAGTACTTTGCAGGACTTCTT
ATGCCCTCAGGAGTGATCCTCTGCAAAGAGGGCAAATGGTTATTTCACAGTGACTATGAC
TTTGGCTATTTAATCAAAATCCTGACAACCTCTAACTTCCCTGAAGAAGAACATGACTTA
TTTGAGATCCTTTGATTATTTTTTCCTGTCATTTAGATGTGAATTACCTCATGAAGTGCT
ACAAAAATTTCAAAAGTGGTTTAAAAGAAGTTGCTGAACAGTTAGAGCTGGAACCGATAG
GACCACATCAAGTAGGATCTGATTCATTGCTCACAAGAATGGCTTTTTTCAACATGAGAG
AAGTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFK
.PAATVDH..RI..V.ACNLD.E.KKI..VI..YNYV.M.TEFP.VVARPIGEFR.NA.Y.YQLL.C.VD.LKII.LGLTFMNEQ...PPGTST.QFNFK
Retrocopy
IPAATVDHN*RISVV*ACNLDKEIKKIHSVI*QYNYVPMGTEFPDVVARPIGEFRNNAGY*YQLL*CSVD*LKII*LGLTFMNEQED*PPGTSTLQFNFK


Parental protein
FNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVI-YDVKYLM
FNLTEDMYAQ.SIELLTTSGI.FKK.E.EGI.TQYFA.LLM.SGV.LC...KWL.FHS.YDFGYLIKILT.SN.PEEE.D.FEIL.LFFPVI..DV.YLM
Retrocopy
FNLTEDMYAQNSIELLTTSGIWFKKPEKEGIDTQYFAGLLMPSGVILCKEGKWL-FHSDYDFGYLIKILTTSNFPEEEHDLFEIL*LFFPVI/LDVNYLM


Parental protein
KSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREM
K..KN.K.GL.EVAEQLELE.IGP.HQ.GSDSLLT.MAFF.MRE.
Retrocopy
KCYKNFKSGLKEVAEQLELEPIGP-HQVGSDSLLTRMAFFNMREV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide