RetrogeneDB ID:
retro_mputfur_1599
Organism:
Location:
GL897316.1:281357-281828 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.02 %
Coverage:
79.61 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
BTF3
Parental gene aliases:
No gene alias available
Parental gene description:
basic transcription factor 3 [Source:HGNC Symbol;Acc:1125]

Genomic region (view in browser)





>retro_mputfur_1599
CCACTCCCAAAAGAAACTATGGTGAACCAGGTGAAACTCACAAAACTGCAAGCACAAGTG
GGCATTGGAGGGAAAGAAACTGTTCGCTGAAAAAAGGTGGTTCATAGGATGGCTACAGCA
GATGATAAAAAACTTTAGTTCTCCTCAAATAAGTTAGGTATCTCTGGCATTGAAAAAGTG
AAAATGTTCACAAACCAAGGAACATGATCCATTTTAACAACCCTAAAGTCCAGGCATCCC
TGGCAGCAAACACTTTCACCATCATGGGCAACGCTGAGTAGCTGATGGAAATGCTACCCA
GTATCTTAAACCAACTTGATGCAGACAGCTTGACTAGTTGAAGAAGACTGGCTGAAGCTC
CCCAGTCAAACAATCTGTAGATGGAAAAGCACCACTAGCTACCAGAGAAGATGAAAAGGA
AGTTCAGATCTTGTGGAGAATTTTGATGACTCTTCCAAGAATGAAGCAAGC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PQMKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGT-VIHFNNPKVQASLAANTFTITGHAETK
P..KET..NQ.KL.KLQAQV.IGGK.T.R.KK.VVHR.ATADDKKL.FS..KLG...ISGIE.V.MFTNQGT..IHFNNPKVQASLAANTFTI.G.AE..
Retrocopy
PLPKETMVNQVKLTKLQAQVGIGGKETVR*KK-VVHRMATADDKKL*FSSNKLG---ISGIEKVKMFTNQGT/MIHFNNPKVQASLAANTFTIMGNAE*-


Parental protein
QLTEMLPSILNQLGADSLTS-LRRLAEALP-KQSVDGKAPLATGEDDDDEVP-DLVENFDEASKNEAN
.L.EMLPSILNQL.ADSLTS.L.......P.KQSVDGKAPLAT.ED...EV..DLVENFD..SKNEA.
Retrocopy
-LMEMLPSILNQLDADSLTS/LKKTG*SSPVKQSVDGKAPLATRED-EKEVQ/DLVENFDDSSKNEAS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide