RetrogeneDB ID:
retro_mputfur_1601
Organism:
Location:
GL897325.1:271221-271519 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.0 %
Coverage:
93.2 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
CDK2AP1
Parental gene aliases:
No gene alias available
Parental gene description:
cyclin-dependent kinase 2 associated protein 1 [Source:HGNC Symbol;Acc:14002]

Genomic region (view in browser)





>retro_mputfur_1601
GGGAGTGTCCACCTGCCATTCCCTAGTATGGCAACATCCTCACAGTACCATCAACTGCTA
AGTGACTATGGGCTACCATCTCTAGGCTACAGCCAGGGAACTGAGAACAGCCAGGTACCC
CAAGGCAAATATGCTGAGTAGGCTGAGTTGCTAGCCATCATTCAGGAGTTGGGGGGAGGA
AATTAGACCCATATATGCAGGGAGGAAGGGTGCCATGAAGAGAGTATAATGAGGCATTAT
TCATACCAGAGGGCTGGTGTGAGAGTGCTTGGTCAAAACTGAATGGAATGCCAGATCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GSVHPPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAE---LLAIIEEL-GKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
GSVH.P..SMATSSQY.QLLSDYG.PSLGY.QGT.NSQVPQ.KYAE...LLAII.EL.G.EIRP.YAG.K.AM.R...GIIH.RGLV.ECL..TE.NARS
Retrocopy
GSVHLPFPSMATSSQYHQLLSDYGLPSLGYSQGTENSQVPQGKYAE*AELLAIIQEL\GEEIRPIYAGRKGAMKRV**GIIHTRGLV*ECLVKTEWNARS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide