RetrogeneDB ID:
retro_mputfur_1602
Organism:
Location:
GL897327.1:428410-429722 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.28 %
Coverage:
100.0 %
Frameshifts:
4
Stop codons:
0


Parental gene:
Parental gene symbol:
PSMC1
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Source:HGNC Symbol;Acc:9547]

Genomic region (view in browser)





>retro_mputfur_1602
ATGGGTCAGAGTCAGAGTGGTGGTCATGCCCCTGTAGGTGGCAAGAAGGATAACAAAGAC
AAGAAAAAGAAATATGAACCTTCTGCACCAACCAGAGTAGGGAAAAAGAAGAAGAAAACA
AAGGAACCAGATGCTACCAGCAAGCTGCCACTGGTGACACATCACACTCAGTACCATTTA
AAATTATTGAAGTTAGAATTGAATACTATCTTCTCACGGAGGAAGAATTCATTAGAAATC
AGGAACAAATGAAGCCTTTAGAAGAAAAGCAAGAGGAGGAAAGATTTAAGAGTGGATGAT
CTGAGGGGGACCCCAAAGTCAATAGGAAACTTGGAAGAGATCCCTGTTGACAATCGTGTT
ATCCTGTCTACATCTGTGGGCTCAGAACACTGCATAAGTATTCTTTCCTTTGTAGACAAA
GATCTACTGGAACCAGGCTGCTCCATCCTGATCAACCACAAGGTACATGCCATCCATGTG
CTCATGGATGACACAGATCCCTTGGTCACAGTGATGAAGGTAGAAAAGTCACTCCAAGAA
ACCTATGCTGATACTGGGCGGCTGGACAACCAAATCCAGGAAATTAAGGAATCTGCAGAG
CTTCCTCTCACTCATCCTGAATATTATGAAGAGATGGTATAAAGCCCCCAGAAGGCATTA
TTCTCTATGGTCCATCTGGCACAAGTAAAACTTTATTAGCCAATGCAGTAGCAAACCAAT
CCTCAGCCACCTTCTTGAGAGTGGTTGGCTCTGAACTTATTCAGAAGTTCCCAGGTCACG
GGCCCAAACTAGTTCGGAAATTGTTTCCAGTTGTGGAAGAACATGCACCAACCACCATGT
TTACTGATGGAATTCATGCCATTGGAACAAAAAGATACAAGTCAAATTCTGGTGGTGAGA
GAGAAATTCAGCAAACAATGTTGGAACTGCTGAGCCAATTGGATGGAGTTGATTTGAGGG
ATGATATGAAAGTTATCGCAGCCACAGACCAAACTGAGACTCTGGATATGGCCCTTATCA
GACCAGGTTGCATCAACAGGAAGCCTGAATTCCCTCAGCCTGACAAAAAGACTAAGAAGT
ACATCTTTCAGATCCACACAAGCAGGGTGACACTAGCTGATGATGGGACTCCAGACGACT
TGATCATGACTAAAGATACCTCTTGGGTGCTAACATCAAGGCAATTTGTACAGAAACTGG
TGTGATGGCCTTCAGAGAATGTAGAATGAAAGTAACAAATGAAGACTTCAAGAAATCTAA
AGAAAATGCTCTTTATAAAAAGCAAGAAGGCATTCCTGAGGGACTGTTTCTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL-KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSK-
MGQSQSGGH.P.GGKKD.KDKKKKYEP..PTRVGKKKKKTK.PDA.SKLPLVT.HTQ..L.K.....RI..YLL.EEEFIRNQEQMKPLEEKQEEER.K.
Retrocopy
MGQSQSGGHAPVGGKKDNKDKKKKYEPSAPTRVGKKKKKTKEPDATSKLPLVTHHTQYHL/KIIEV-RIEYYLLTEEEFIRNQEQMKPLEEKQEEERFK\


Parental protein
VDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIK
VDDLRGTP.S.G.LEEI..DN..I.STSVGSEH..SILSFVDKDLLEPGCS.L.NHKVHA.I.VLMDDTDPLVTVMKVEK..QETYAD.G.LDNQIQEIK
Retrocopy
VDDLRGTPKSIGNLEEIPVDNRVILSTSVGSEHCISILSFVDKDLLEPGCSILINHKVHA-IHVLMDDTDPLVTVMKVEKSLQETYADTGRLDNQIQEIK


Parental protein
ESVELPLTHPEYYEEM-GIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDS
ES.ELPLTHPEYYEEM.GIKPP.G.ILYGP.GT.KTLLA.AVANQ.SATFLRVVGSELIQK..G.GPKLVR.LF.V.EEHAP...F.D.I.AIGTKRY.S
Retrocopy
ESAELPLTHPEYYEEM/GIKPPEGIILYGPSGTSKTLLANAVANQSSATFLRVVGSELIQKFPGHGPKLVRKLFPVVEEHAPTTMFTDGIHAIGTKRYKS


Parental protein
NSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDD-LSGADIK
NSGGEREIQ.TMLELL.QLDG.D.R.D.KVI.AT...ETLD.ALIRPG.I.RK.EFP.PD.KTKK.IFQIHTSR.TLADD.T.DDLIM.KD..L.GA.IK
Retrocopy
NSGGEREIQQTMLELLSQLDGVDLRDDMKVIAATDQTETLDMALIRPGCINRKPEFPQPDKKTKKYIFQIHTSRVTLADDGTPDDLIMTKDT/LLGANIK


Parental protein
AICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL
AICTE.G.MA.RE.RMKVTNEDFKKSKEN.LYKKQEG.PEGL.L
Retrocopy
AICTETGVMAFRECRMKVTNEDFKKSKENALYKKQEGIPEGLFL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide