RetrogeneDB ID:
retro_mputfur_1603
Organism:
Location:
GL897329.1:359803-361009 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
94.03 %
Coverage:
74.72 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RIPK2
Parental gene aliases:
No gene alias available
Parental gene description:
receptor-interacting serine-threonine kinase 2 [Source:HGNC Symbol;Acc:10020]

Genomic region (view in browser)





>retro_mputfur_1603
ATGAACCAGGAGGGTATCTGCAGCGCCCTGCCTACCATTCCCTGCCACAAGCTCCCCGAC
CTGCGCTACCTGAGCCGCAGCGGGTCAGGCACCGTGTCCTCTGCCCGCCACGCAGACTGG
CGCATTCAGGTTGCCGTGAAGCAGCTGCACATCCACACCCCGCTGCTCGACAGTGAAAGA
AATGATGTTTTAGGAGAAGCTGATATTTTACACAAAGCTAGATTTAGTTACATTCTTCCA
ATTTGGGGAATTTGCAATGAGCCTGAATTTTTGGGAATAGTTACGGAATATATGCCAAAT
GGATCATTAAATGAATTCCTCCATAGGAAAACGGAATATCCTGATGTTGCTTGGCCACTG
AGATTTCGCATCCTGCATGAAATTACACTGGGTGTAAACTACTTGCACAATATGAATCTT
CCTCTACTTCATCATGACTTAAAGACTCAAAATATCTTACTGGATAATGAATTTCATGCT
AAGATTGCAGATTTTGGTTTATCAAAATGGCGTATGATGTCCCTCTCACAAACATGGACT
AGTAAATCTTCACCAGAAGGATGGACAATTATCTATATGCCACCTGAGAACTATGAACCT
GGACAAAAATCAAGAGCCAGTGTCAAGCATGATATCTATAGCTTTGCAGTGATCATGTGG
GAAGTCTTATCCAGAAAACAGCCTTTTGAAGAAGTCACCAATCCTTTGCAGATCATGTAT
AGTGTATCACAAGGACATCGACCTAACACTAATGAAGAAAGTTTGCCACTTGATATACCT
CATCGAACACTTATGATCTCTCTAATAGAAAGTGGATGGGCACAAAATCCAGATGAAAGA
CCATCTTTCTTAAAATGTTTAATAGAACTTGAACCAGTTCTGAGGACATTTGAAGAGATA
ACTTTTCTTGAAGCTGTTATTCAACTAAAGAAAACAAAGTTACAGAGTACTTTGAGCACT
ATTCACTTATGTGACAAGAAGAAAATGGACTCATCTCTGAACACACCTATAACTCATGGA
CCACAGAAGGAATCATGTGGATCCTCTCAGCTCCATGAAAGTAGTGATTCTACTATAGCC
TCAAAGTCCCTGACAGCTCCTCAAGAAAATGATTTTTTATCTAGAAAAACTCAAGACTTT
TCTACACTGTGTCACTATCCAGTAAATCACAGTTGCAATAGTAACATTTCTGTTCAGTTC
AGAAGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MNREGICSALPTIPCHKLADLRYLSRGASGTVSSARHADWRVQVAVKQLHIHTPLLDSERNDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPN
MN.EGICSALPTIPCHKL.DLRYLSR..SGTVSSARHADWR.QVAVKQLHIHTPLLDSERNDVL.EA.ILHKARFSYILPI.GICNEPEFLGIVTEYMPN
Retrocopy
MNQEGICSALPTIPCHKLPDLRYLSRSGSGTVSSARHADWRIQVAVKQLHIHTPLLDSERNDVLGEADILHKARFSYILPIWGICNEPEFLGIVTEYMPN


Parental protein
GSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRTSKSSPEGGTIIYMPPENYEP
GSLNE.LHRKTEYPDVAWPLRFRILHEI.LGVNYLHNMN.PLLHHDLKTQNILLDNEFH.KIADFGLSKWRMMSLSQ..TSKSSPEG.TIIYMPPENYEP
Retrocopy
GSLNEFLHRKTEYPDVAWPLRFRILHEITLGVNYLHNMNLPLLHHDLKTQNILLDNEFHAKIADFGLSKWRMMSLSQTWTSKSSPEGWTIIYMPPENYEP


Parental protein
GQKSRASIKHDIYSFAVIMWEVLSRKQPFEEVTNPLQIMYSVSQGHRPNTNEESLPLDIPHRTLMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
GQKSRAS.KHDIYSFAVIMWEVLSRKQPFEEVTNPLQIMYSVSQGHRPNTNEESLPLDIPHRTLMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
Retrocopy
GQKSRASVKHDIYSFAVIMWEVLSRKQPFEEVTNPLQIMYSVSQGHRPNTNEESLPLDIPHRTLMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI


Parental protein
AFLEAVIQLKKTKLQSTLSTIHLCDMKKMDSSLNTPITHGPQEESCGSSQLHESSDSAIASKSLTAPQENDFLSRKTQDFSTLCHYPVNHSCNSNISAVQ
.FLEAVIQLKKTKLQSTLSTIHLCD.KKMDSSLNTPITHGPQ.ESCGSSQLHESSDS.IASKSLTAPQENDFLSRKTQDFSTLCHYPVNHSCNSNIS...
Retrocopy
TFLEAVIQLKKTKLQSTLSTIHLCDKKKMDSSLNTPITHGPQKESCGSSQLHESSDSTIASKSLTAPQENDFLSRKTQDFSTLCHYPVNHSCNSNISVQF


Parental protein
KR
.R
Retrocopy
RR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide