RetrogeneDB ID:
retro_mputfur_1606
Organism:
Location:
GL897348.1:154813-155328 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
86.78 %
Coverage:
54.06 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
AIMP1
Parental gene aliases:
No gene alias available
Parental gene description:
aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 [Source:HGNC Symbol;Acc:10648]

Genomic region (view in browser)





>retro_mputfur_1606
TCAGTAGCAGGAAGCACTGACTCTAAGCCAGTAGATGTTTCTCGTCTGGATCTTTGAGTT
GGTTATATCATCACTGCCAGAAAACATCCTGATGCAGATTCTTTATATGTAGAAGAAGTA
GATGTTGGAGAAACAGCCCCAAGAACAGTTGTCAGTGGTCTGGTGAATCATGTTCCTCTT
GAATAGATGCAAAATTGGATGGTGATTTTACTTTGTAACCTGAAACCTGCAAAAATGAGG
GGGGTAATATCTCAAGCAATGGTGATGTGTCCTAGTTCAACTGAGAAGGTTGAAATCTTG
GCATCTCCTAATGGGTCTATTCCTGGAGACAGAATTATTTTTGATGCTTTTCCTGGAGTC
CTGACAAGGAGCTAAATCCTAGGATGATTTGGGAGGATATCTAGCCTGATCTCTTTACTA
ATGATGTGTGTGTGACTACACGTAAAGGAGCTCCCTTTGAGGGGAAAGAGAAGGGAGTGT
ATAGGGCTCAAACTATGACCAATAGTGGAATAAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SVAGSIDSKPVDVSRLDLRVGCIITARKHPDADSLYVEEVDVGETAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVISQAMVMCASSPEKVEIL
SVAGS.DSKPVDVSRLDL.VG.IITARKHPDADSLYVEEVDVGETAPRTVVSGLVNHVPLE.MQN.MVILLCNLKPAKMRGVISQAMVMC.SS.EKVEIL
Retrocopy
SVAGSTDSKPVDVSRLDL*VGYIITARKHPDADSLYVEEVDVGETAPRTVVSGLVNHVPLE*MQNWMVILLCNLKPAKMRGVISQAMVMCPSSTEKVEIL


Parental protein
APPNGSVPGDRIVFDAFPG-EPDKELNPKKKIWEQIQPDLFTNDECVATYKGAPFEVKGKGVCRAQTMTNSGIK
A.PNGS.PGDRI.FDAFPG..PDKELNP...IWE.I.PDLFTND.CV.T.KGAPFE.K.KGV.RAQTMTNSGIK
Retrocopy
ASPNGSIPGDRIIFDAFPG/SPDKELNP-RMIWEDI*PDLFTNDVCVTTRKGAPFEGKEKGVYRAQTMTNSGIK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide