RetrogeneDB ID:
retro_mputfur_1607
Organism:
Location:
GL897348.1:326517-327040 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.19 %
Coverage:
50.14 %
Frameshifts:
5
Stop codons:
0


Parental gene:
Parental gene symbol:
MDH2
Parental gene aliases:
No gene alias available
Parental gene description:
malate dehydrogenase 2, NAD (mitochondrial) [Source:HGNC Symbol;Acc:6971]

Genomic region (view in browser)





>retro_mputfur_1607
GCCCTTGCCTGGCCTGCCCGCACTGCTCCCACAGCAGCTTCAGCACCTGGACCAAGAACA
GTGTGTAAAGTAGCTGTGCTAGGACTTTTGGAGGAATAGGGCAGCCCCTTTCACTTCTCC
TCAAAACATACCCTTGGTAAGCCTCCTGAATGTCTACAATGTTGCTCATGTACCTGAGTA
GCCACAGATCAAAGCCACATTGAGATCAAAGCAACTATGAAAGGCTACCTTGAACCTAAG
CAGTTGTCAGACTGCCTGAAAAATTGTGATGTGGTAGTTATTCCAGTAGGAGTCTTGAGA
AAACCAGGCATGACACAGGATATCTGTTCCAGACCAATGCCACAGTTGTGGCTACCCTGA
CTACTGCCTGTGCCCAGCATTGCCCTGAGGCCATGAGCTGTACCACTTTAAATGTGATTA
ACTCCACCATCCCAATCACAACAGCATTTTCAAGAAACATGGAACATACAACCCCAATAA
AATCTTTGGGGTGACAACCCTGGGCATTATCAAAACCAACACT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ALARPAGAALRRSFSTSAQKNAKVAVLG-ASGGIGQPLALLLK-NSPLVSRLTLYDIAHTPG-VAADLSHIETRATVKGYLGPEQLPDCLKGCDVVVIPA
ALA.PA..A.............KVAVLG...GGIGQPL.LLLK.N.PLVS.L..Y..AH.P..VA.D.SHIE..AT.KGYL.P.QL.DCLK.CDVVVIP.
Retrocopy
ALAWPARTAPTAASAPGPRTVCKVAVLG/TFGGIGQPLSLLLK/NIPLVSLLNVYNVAHVPE/VATDQSHIEIKATMKGYLEPKQLSDCLKNCDVVVIPV


Parental protein
GVPRKPGMTRD-DLFNTNASIVATLTAACAQHCPEAMICIISNPVNSTIPIAT-EVFKKHGAYNPNKIFGVTTLDIVRANT
GV.RKPGMT.D..LF.TNA..VATLT.ACAQHCPEAM.C...N..NSTIPI.T...FKKHG.YNPNKIFGVTTL.I...NT
Retrocopy
GVLRKPGMTQD/YLFQTNATVVATLTTACAQHCPEAMSCTTLNVINSTIPITT/SIFKKHGTYNPNKIFGVTTLGIIKTNT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide