RetrogeneDB ID:
retro_mputfur_1608
Organism:
Location:
GL897351.1:111009-111423 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.31 %
Coverage:
80.35 %
Frameshifts:
3
Stop codons:
5


Parental gene:
Parental gene symbol:
MRPS25
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial ribosomal protein S25 [Source:HGNC Symbol;Acc:14511]

Genomic region (view in browser)





>retro_mputfur_1608
TCAGTGAAGGTCATGACTGTGAAATACAACATGCACAAGGAGCTGGACAAGGGCACCAGG
AAATTTGTGTTTTTCAACATATCTAAGAACAAGTAGAAAAAACCTTAGGTGCAGATCATG
ATGTTTAGAAACGGGATGCCATCTCCATTTCTGAGGTTCTATCTTCATTCCAGATAGCAG
GTACTCATGGATGTAGAGACCAGTTATAATAAAGAGATCATGGAGCACATCCAACAGATC
TTGTAGAAGAACAAGGAGATCCTCAAAAAGAGGAATAAGAGAAAAAGCAGCTTTCTCACC
TATCCCACTGGCTCCCAGAAGTACTGTCTGCTGAACTGCATCTGTAAAGTGAAAGGGCAG
GTCTCTTGCCTGGGCCTGGTGCCATTACCCAAGGTGATGACAGGGAAGTACAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIKKILGKNKETL-EEEEQKKKQLS
SVKVMTV.YN.H.EL..G.RKFVFFNI.....K.P.VQIMMF.N..PSPFLRFYL.S..QVL.DVET..NKEIMEHI..IL.KNKE.L...EE..KKQLS
Retrocopy
SVKVMTVKYNMHKELDKGTRKFVFFNISKNK*KKP*VQIMMFRNGMPSPFLRFYLHSR*QVLMDVETSYNKEIMEHIQQIL*KNKEIL/QKEE*EKKQLS


Parental protein
H-PAHFGPR-KYCLRECICEVEGQVPCPGLVPLPKELTGKYK
H.P....PR.KYCL..CIC.V.GQV.C.GLVPLPK..TGKYK
Retrocopy
H/PIPLAPR/KYCLLNCICKVKGQVSCLGLVPLPKVMTGKYK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide