RetrogeneDB ID:
retro_mputfur_1610
Organism:
Location:
GL897358.1:315749-316179 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
86.99 %
Coverage:
86.14 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
METTL9
Parental gene aliases:
No gene alias available
Parental gene description:
methyltransferase like 9 [Source:HGNC Symbol;Acc:24586]

Genomic region (view in browser)





>retro_mputfur_1610
CTGTCTGAAACTAAGATATGGCAGCTTCAGAAGAAGAAATACAGAGTGCTTGGTATAAAC
GAATGGCAGAACACAGGGTTCCAGTATGATATTATCAGCTGCTTGAATTTGCTGGACTGC
TGTGATCAGCCCCTAAATTTGTTAAAAGATAACAGAAGTGTCTAGGAGCCAACTGAGGCA
GGGTCATCCCGCCCTGGTTTTACCCTTTCATCCCTATGTGGAAAACATAGGTGGCATATG
GGGGAAACCATCAGAAATTTTAGAAATCAAGGGACAGAACTGGGAAGAACAAGAGAATAG
TCTGCCGGAAGTTTTCAGAAAAGCTGCTTTTGTTATCGAAGCTTTCACCGGAGTACCATA
CCTGTGTGAAGGCGACATGTATAATGACTACTACGTTCTGGATTACTCTGTCTTTGTTCT
CAAACCAGTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTR-GRVIL-ALVLPFHPYVEN-GGKWEKPSEILEIKGQNWEEQ
LSET.IWQLQKKKYRVLGINEWQNTGFQYD.ISCLNLLD.CDQPL.LLKD.RSV.EPT..GRVI..ALVLPFHPYVEN.GG.W.KPSEILEIKGQNWEEQ
Retrocopy
LSETKIWQLQKKKYRVLGINEWQNTGFQYDIISCLNLLDCCDQPLNLLKDNRSV*EPTE/GRVIP/ALVLPFHPYVENIGGIWGKPSEILEIKGQNWEEQ


Parental protein
VNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV
.NSLPEVFRKA.FVIEAFT..PYLCEGDMYNDYYVLD..VFVLKPV
Retrocopy
ENSLPEVFRKAAFVIEAFTGVPYLCEGDMYNDYYVLDYSVFVLKPV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide