RetrogeneDB ID:
retro_mputfur_1616
Organism:
Location:
GL897370.1:208097-208555 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.69 %
Coverage:
98.71 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
FAM162A
Parental gene aliases:
No gene alias available
Parental gene description:
family with sequence similarity 162, member A [Source:HGNC Symbol;Acc:17865]

Genomic region (view in browser)





>retro_mputfur_1616
GGAGCTTTGTGCGGCCTGCACAGACCGGTGGGAAGTTATTTTAGTTTATATGAAAGAGAT
GTTTCCTCATCTCTAAGATTTACCAGAAATCTTGATTTGAAGACAGTAAATGGATTTTGC
ACCAAACCACAAGAAAGACCAGAAGCTCCACCCTACACTTAGAGCTGCAGAGTACCATTA
CACAAACCTACAAGTTGGGAGAGGAAGATCCTGATATCACCAGGTTGCTTCAAAAAGGAA
GATGAGATCCCAGCGGCTATCTTGTTCAAGACGGTTGATGCTGCCAAGAACAAGATTTGG
GGGAAGATCAGCTATGTAATGACTGCCCTGTGGCAGGACGCATTTTGGTGGTTACTGAGG
GCAAGAAGGCTGTCATCAAAGGAAACGAGTCTTTAACAAGACTGAACTTGGAGCAGAAAG
CTTGCCTGAAAGAGGAAGCAGCCACAAAGGCCAAGACA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GSLRGLRQAAGSYFRLYESGSSSSLRLTRNSDLKRINGYCAKPQESPKAPAYTYSHRVPLHKPTNWERKILIWSGRFKKEDDIPETISFEMLDAAKNKIR
G.L.GL....GSYF.LYE...SSSLR.TRN.DLK..NG.C.KPQE.P.AP.YT.S.RVPLHKPT.WERKILI..G.FKKED.IP..I.F...DAAKNKI.
Retrocopy
GALCGLHRPVGSYFSLYERDVSSSLRFTRNLDLKTVNGFCTKPQERPEAPPYT*SCRVPLHKPTSWERKILISPGCFKKEDEIPAAILFKTVDAAKNKIW


Parental protein
VKVSYAMIALTVAGCIWMVIEGK-KAVKRNESLTSLNLEKKARLREEAALKAKT
.K.SY.M.AL......W..........K.NESLT.LNLE.KA.L.EEAA.KAKT
Retrocopy
GKISYVMTALWQDAFWWLLRARR/AVIKGNESLTRLNLEQKACLKEEAATKAKT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide