RetrogeneDB ID:
retro_mputfur_1618
Organism:
Location:
GL897378.1:143400-143975 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.56 %
Coverage:
55.46 %
Frameshifts:
4
Stop codons:
3


Parental gene:
Parental gene symbol:
RGN
Parental gene aliases:
No gene alias available
Parental gene description:
regucalcin [Source:HGNC Symbol;Acc:9989]

Genomic region (view in browser)





>retro_mputfur_1618
GCCAGTTCTCCAAGGGTCACTGACACCAAGACAGCTTCCGGTTAACAATGTCTTCCATTA
AAATCGAATGTGTTTTGCGGGAGAATTGCTGGGGCAGGGAGTCTCCGGTGCAGGAGGAGG
TATCCATCTCACCGCCCTTTATAGATATTCTTGCAAGAAACCTTTGCCAGTGGGATTCGC
TCAGCAAGTGCGTGCAGCAAGTGACTGTGGATGCCCCATTGGCTCTGATCCCTTCACCAG
GGAGGAGGCTATGTCACCACCACAGGAACAAAGTTCTGTGCTCTGAACTGGGAAGATCAC
TCAGCAGTTTCCCTGGCCACAGGAGATAAAGACCAGAAAAACAATTGATTCAATAATGGG
AAGGTAGATCCTGTTGGGAGATATTTTGCTGGCATCATGGCCAAGGAGACCACCCAACAG
CTGTGGGGTGGCACCACAGGTCCCTGTACTCCCTCTTTCTGGACCACCAAGTGGAAAAGT
ATTTTGAGCAGGTGGACATCTCCAATGGTTTGGATTGATCCCTGGATCACAAAATCTTCT
ATTACATCGGCAGCCTGTCTTACTAGTTGGATGCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ASSLRVTD-NQDSSLFTMSSIKIECVLRENCRCGESPVWEEASSSLLFVDIPAKKVCRWDSLSKRVQQVTLDA-PVSSV-ALRQGGGYVATVGTKFCALN
ASS.RVTD..QDS...TMSSIKIECVLRENC...ESPV.EE.S.S..F.DI.A...C.WDSLSK.VQQVT.DA.P..S...L.QGGGYV.T.GTKFCALN
Retrocopy
ASSPRVTD/HQDSFRLTMSSIKIECVLRENCWGRESPVQEEVSISPPFIDILARNLCQWDSLSKCVQQVTVDA/PIGSD/SLHQGGGYVTTTGTKFCALN


Parental protein
WEDHSAVALASVDEDKRNNRFNDGKVDPAGRYFAGTMAEETA-PAVLERHQGSLYSLFPDHHVEKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDA
WEDHSAV.LA..D.D..NN.FN.GKVDP.GRYFAG.MA.ET..P.....H..SLYSLF.DH.VEKYF.QVDISNGLD.SLDHKIFYYI.SLSY..DA
Retrocopy
WEDHSAVSLATGDKDQKNN*FNNGKVDPVGRYFAGIMAKETT/PTAVGWHHRSLYSLFLDHQVEKYFEQVDISNGLD*SLDHKIFYYIGSLSY*LDA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide