RetrogeneDB ID:
retro_mputfur_1619
Organism:
Location:
GL897381.1:240416-240844 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
82.31 %
Coverage:
90.06 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
ACP1
Parental gene aliases:
No gene alias available
Parental gene description:
acid phosphatase 1, soluble [Source:HGNC Symbol;Acc:122]

Genomic region (view in browser)





>retro_mputfur_1619
TGTCTGGGTAACATCTGTCTATCAACCCATTGCAGAAGCAGTGTTCAGAAAACTTGTAAC
TGACCAAAAGCTTTCAGATCATTGGAGGATAAACAGTGCAGAGATATGCACGTATAAAAT
AGGAAACCCTCCTGATTACCGAGAGCAGAGTTGCATGAAGAAGCATGGCATCCCCATGAG
TCACACTGCCTGGCAGTTTACCAAGGAAGACTTTGCCACATTCAGTTATATACTGTGTAT
GGATGAAATCAATCTGAGAGACTTGAATACAAATAGTAATCAAATTAAAAACTGCAAAGC
TAAAATTGAGCTACTTGGGAGCTATGATCCACAAAACCAACTCCATTGTTAAAGGCCCCT
ATTATTCCGACTTCAAGATTGTCTAACAGCAGTGTGTGAGGTGCTGCAAGGCCTTCCTGG
AGAAGGCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
CSCNICRS-PIAEAVFRKLVTDQKLSDHWRIDSAATSTYEIGNPPDYRGQSCMKKHGIPMSHTARQVTKEDFATFDYILCMDESNLRDLNRKSNQIKNCK
C..NIC.S.PIAEAVFRKLVTDQKLSDHWRI.SA...TY.IGNPPDYR.QSCMKKHGIPMSHTA.Q.TKEDFATF.YILCMDE.NLRDLN..SNQIKNCK
Retrocopy
CLGNICLS\PIAEAVFRKLVTDQKLSDHWRINSAEICTYKIGNPPDYREQSCMKKHGIPMSHTAWQFTKEDFATFSYILCMDEINLRDLNTNSNQIKNCK


Parental protein
AKIELLGSYDPQNQL-IIEDPYYGNESDFETVYQQCVRCCKAFLEKA
AKIELLGSYDPQNQL.I...PYY...SDF..V.QQCVRCCKAFLEKA
Retrocopy
AKIELLGSYDPQNQL\IVKGPYY---SDFKIV*QQCVRCCKAFLEKA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide