RetrogeneDB ID:
retro_mputfur_1620
Organism:
Location:
GL897385.1:104991-105308 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.8 %
Coverage:
61.71 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1620
ATAAGCTTCCAAATTAGTTAGAATTATTCCATCTAGGTAGAGACCATTAAGCACCTGGTC
ACAGCATGCATCTATACGCCTCCTACGCTTACCTCTTTGGCTTCTATTTCTGCTGTGATG
ATGTGGCTCTTGGAGACACAGGCCACTTCTTCCAGGAGCTGGCCAAGGAGAAGCTGAGGG
TACCAGGCCTTTCTAAGATGCAAAAACAATGCTGTGGCCATGCTCTCTTCCAGGACTTAC
AGAAGCTTTCCCAAGATGAATGGGACAAAAACCTGGACACCACGGAAGCCACCAGGGTCC
TGGAGAAGAACCTGAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSSQIRQNYSTEVEAAVNRLV-NMHLRASYTYLSLGFYFDRDDVALEGVGHFFRELAEEKREGAERLLKMQNQRGGRALFQDVQKPSQDEWGKTLDAMEA
.S.QI..NYS..VE.........MHL.ASY.YL..GFYF..DDVAL...GHFF.ELA.EK......L.KMQ.Q..G.ALFQD.QK.SQDEW.K.LD..EA
Retrocopy
ISFQIS*NYSI*VETIKHLVT/SMHLYASYAYL-FGFYFCCDDVALGDTGHFFQELAKEKLR-VPGLSKMQKQCCGHALFQDLQKLSQDEWDKNLDTTEA


Parental protein
ALVLEKSLN
..VLEK.LN
Retrocopy
TRVLEKNLN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide