RetrogeneDB ID:
retro_mputfur_1621
Organism:
Location:
GL897386.1:228737-229172 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.31 %
Coverage:
74.24 %
Frameshifts:
0
Stop codons:
6


Parental gene:
Parental gene symbol:
FCF1
Parental gene aliases:
No gene alias available
Parental gene description:
FCF1 rRNA-processing protein [Source:HGNC Symbol;Acc:20220]

Genomic region (view in browser)





>retro_mputfur_1621
GGGAAGCAAGAGAAAGCAAGAAAGTATGTGACTTGTAAGTGAATGCTTACCTCCGAGATC
CTTCTCCGAGAGAAGGACAGATTAAAACCTAAAAAGAAAGAAAAAAAAATTTCCCGTGCT
CTCAAGGAAAGAGAAGTCCCCCTACATCCCTCCTGATTTTTCTAGTATAAACACACAGCT
GGGTCACCTTACCACATCCTGGTTGGTACTGACTTTATCAACTTTTCTATTTAAGCCAAA
CTTGACCGGGTACAGTCAATGATGGACAGGCTGTGTGCCAAGTGTACCAGTTGTACAACT
GACTGTGTAATGGCTGAAACTGAGAAACCGGGGTGAAAGTATCAAGTGGCTCTAAGGATT
GCCAAAGAGCCAAGATTCAAATGATTACCACGTACACACAAGACAAACTACGCAGATGAC
TGCTCAGTACGGAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GKQKKARKYATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPC
GKQ.KARKY.T.K.ML......L.EKDRLKP.........ALKEREVP.HPS..FF.Y....G.PYHILV.T.FINFSI.AKLD.VQSMMD.L.AKC..C
Retrocopy
GKQEKARKYVTCK*MLT-SEILLREKDRLKPXXXXXXXSRALKEREVPLHPS*-FF*YKHTAGSPYHILVGTDFINFSI*AKLDRVQSMMDRLCAKCTSC


Parental protein
ITDCVMAEIEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQR
.TDCVMAE.EK.G.KY.VALRIAK.PRF..LP.THK..YADDC.V..
Retrocopy
TTDCVMAETEKPG*KYQVALRIAKEPRFK*LPRTHKTNYADDCSVRK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide