RetrogeneDB ID:
retro_mputfur_1622
Organism:
Location:
GL897388.1:217675-218048 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
78.12 %
Coverage:
51.01 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
TPGS2
Parental gene aliases:
No gene alias available
Parental gene description:
tubulin polyglutamylase complex subunit 2 [Source:HGNC Symbol;Acc:24561]

Genomic region (view in browser)





>retro_mputfur_1622
GGAAGGGGGGAGGTTTGCCTTGTCTACAAAAGAGGGAAACCAGTGTTAGCACAGGACACT
GAGATCTGTTCCTGGGCAGAGCATTATCCTGGCATTTTCTCACGGGCGCCTTCACCGCTT
ACAGTCACCTGCTCATCAGGCAGCTGGGCCTGTTGCAGTGGCAGTACGCCTTCACCAGCT
ATGGCATTAGCCCACAGGCCAAGCAGTGGTTCAACATGTATAAACCCATCACCAACAACA
CAGACCTATTTGCAGAAAAGAACAGCTCCTTCATGAACAAGCTGGATCCCAGCAAACTGT
TCAAGAGCAAGAACAAGACCTTAATCCCCAGAAAGGGGCAGTGCAGACTGCAGGTGGTCA
GAAAGGGCCTCCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GNGKVCLVYKRGKPALAQDTEIW-FLDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFNMYKPVTYNTDLLAEETNSFVNKLDPSK
G.G.VCLVYKRGKP.LAQDTEI..FL.RAL.WHFLT..FTAY..LLI..LGL.QWQYAFTSYGISPQAKQWFNMYKP.T.NTDL.AE...SF.NKLDPSK
Retrocopy
GRGEVCLVYKRGKPVLAQDTEIC/FLGRALSWHFLTGAFTAYSHLLIRQLGLLQWQYAFTSYGISPQAKQWFNMYKPITNNTDLFAEKNSSFMNKLDPSK


Parental protein
VFKSKNKT-LIPKKKGPVQPAGGQKGPP
.FKSKNKT.L.P.K.G.VQ.AGGQKGPP
Retrocopy
LFKSKNKT/LNPQK-GAVQTAGGQKGPP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide