RetrogeneDB ID:
retro_mputfur_1624
Organism:
Location:
GL897409.1:114257-114596 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
52.14 %
Coverage:
79.43 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
RPL26L1
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L26-like 1 [Source:HGNC Symbol;Acc:17050]

Genomic region (view in browser)





>retro_mputfur_1624
ATGAAGTTCAAATCCTCTGTGACTTCTGACTAGTGTAAGAACCATAAAGGGCATTTTATT
AAAGCCCCTTCCCACATTTGCAGCAAGATTATGTCCCTCCTCTGCCCAAACATCTGAAAC
AGAAGTGCAGTGTTCAATCCATGCCCATCTGAAAGGATGACGTCATTCTAGTTCTTGCAG
GACAACACAAAAGTCAGCAAATTGGTAACATAGTCCAGGCTTGAAAGAGCTCCAGCGTCT
ACACGGAGCAGGTGCAACAGGAGAAGGCTAATGGCACATTGTCTGTGCAGCGTGCCCCCT
CACAAGGGTGTTAACACTAGACTAATACCAGACAGAGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKFNPFVTLDRSKNRKRHF-NAPS-VRRKIMS-SPL-KELRQKYNIRSMPIRKDDDVQMVRGHYKGQQIGKVVQVHRKKYVIYIEQVQHEKANGTTVHVG
MKF...VT.D..KN.K.HF..APS....KIMS..PL.K.L.QK....SMPI.KDD......G..K.QQIG..VQ......V.Y.EQVQ.EKANGT...V.
Retrocopy
MKFKSSVTSD*CKNHKGHFIKAPSHICSKIMS/PPLPKHLKQKCSVQSMPI*KDDVILVLAGQHKSQQIGNIVQA*KSSSV-YTEQVQQEKANGT-LSVQ


Parental protein
IHPS-KVVITRLKLDKD
..PS.K.V.TRL..D.D
Retrocopy
RAPS\KGVNTRLIPDRD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide